KEGG   Bordetella trematum: SAMEA390648703850Help
Entry
SAMEA390648703850 CDS       T04322                                 

Gene name
pheA_2
Definition
(GenBank) P-protein (includes chorismate mutase and prephenate dehydratase)
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
btrm  Bordetella trematum
Pathway
btrm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01130  Biosynthesis of antibiotics
btrm01230  Biosynthesis of amino acids
Module
btrm_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
btrm_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAMEA390648703850 (pheA_2)
Enzymes [BR:btrm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     SAMEA390648703850 (pheA_2)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SAMEA390648703850 (pheA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HrpE
Motif
Other DBs
NCBI-ProteinID: SAI73795
UniProt: A0A146A761
LinkDB All DBs
Position
1:complement(4114218..4115303)
Genome map
AA seq 361 aa AA seqDB search
MDDSLQAKLRPLRDRIDTIDAQILDLLSQRARTALEVGEVKHAAQADGPVLRPEREAEVI
RGLQSRNPGPFPNSAVAAVWTEIMSACRGLERGMTIAYLGPQGSFSEQAALEQFGRSVTQ
LPCTSFDEVFRAIEGGQADAGIVPIENSTEGAVNRNLDLLLHTPLKIMGERSLLIRHCLM
TQSGTMEGIQTISAHPQALAQCQGWLARHYPDLKRVAAASNSEAARVAAGDPTVAAIAGE
VAAPAWGLSIVAAGIQDDAQNRTRFLALGHIEPLPSGRDKTSVILAVPNRAGAVYDMLAP
LAVNGVSMTRFESRPARTGQWEYYFYIDCMGHQHDSNVRAAFAALAEQAAFFKILGSYPA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatgattccctgcaggccaagctgcggccgctgcgcgaccgcatcgacacgattgac
gcgcagatcctggatctgcttagccagcgcgcccgcaccgccctggaagtgggcgaggtc
aagcacgctgcccaggccgatggcccggtgctgcgtccggagcgcgaagccgaggtcatc
cggggtttgcaaagccgcaatcccgggccgtttcccaattcggcagtcgccgccgtctgg
actgaaatcatgtccgcctgccgggggctggagcgtggcatgaccatcgcctatcttggg
ccgcagggttcgttttccgagcaggccgccctggagcagttcggtcgttcggtcacgcag
ctgccttgcacctcctttgacgaagtgttccgcgccatcgagggcgggcaggccgatgct
ggcatcgtgccgatcgagaactccaccgagggcgcggtcaaccgcaacctggatctgctg
ctgcatacgccgctcaagatcatgggggagcgttccctgttgatccgccactgcctcatg
acccaatcgggcaccatggaaggcatccagaccatctccgcccacccgcaggcgctggcg
cagtgccagggctggctggcgcgccactatcccgacctcaagcgggtggcggcggccagc
aactcggaagccgcccgcgtggcggcaggcgaccccaccgtggcagccattgccggggaa
gtggcggcgccggcctgggggctgagcatcgtcgccgccggcatccaggatgacgcccag
aatcgcacccgttttctcgcgctggggcacatcgagccgctgcccagcggccgcgacaag
accagcgtgattctggccgtgcccaatcgcgccggcgccgtctatgacatgctggcgccg
ttggcggtcaatggcgtgtccatgacgcgcttcgagtcgcgtccggcgcgcaccggccaa
tgggagtattacttctacatcgactgcatgggccaccagcacgacagcaacgtgcgcgct
gcctttgccgccctggccgagcaggccgctttcttcaagatcctgggctcctatccggcc
cagtaa

DBGET integrated database retrieval system