KEGG   Bordetella trematum: SAMEA390648703950Help
Entry
SAMEA390648703950 CDS       T04322                                 

Gene name
yggG_3
Definition
(GenBank) exported peptidase
Organism
btrm  Bordetella trematum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48
Motif
Other DBs
NCBI-ProteinID: SAI74022
UniProt: A0A157LTP8
LinkDB All DBs
Position
1:complement(4201170..4201988)
Genome map
AA seq 272 aa AA seqDB search
MSRMLARIPAYLLAAALAGCAGISTTQSGAVGVDRKQYVSGLVPQAQLEQEARKQYQAVL
NQARSQGRLDRDAAQLQRIKSITQRLVAQVPVFRGDARDWDWEVHLISEDEVNAWCMPGG
KMAVYSGLIQRIQPTDDELAAVLGHEIAHALREHARERVSQQMAAQLGLTVLSILTGSQR
ATDLGSNLSQVMFTLPNSRSHESEADLIGVELAARAGYDPRAAVTLWQKMGAAQGAQAPP
EFLSTHPSAATRIGDLQQAAQRVMPLYEQSRR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggatgcttgcccggattcctgcgtacttgctggctgctgcgctggccggttgt
gccgggatcagtacgacgcaatccggtgcggtcggcgtcgaccgcaagcagtatgtgtcc
gggctggtgccgcaggcccagcttgaacaggaggcgcgcaaacagtaccaggcggtgctg
aatcaggcgcgcagccagggcaggctggaccgcgatgcggcccagctccagcgcatcaag
tccattacccaacgcctggtcgcgcaggtgccggtgtttcgcggcgatgcccgcgactgg
gactgggaagttcacctgatcagcgaggacgaggtgaacgcctggtgcatgccgggtggc
aagatggcggtctattcagggctgatccagcgcatccagccgacggatgatgaactggcc
gcagtactggggcacgagatcgcgcatgccttgcgcgaacatgcgcgcgagcgggtttcc
cagcagatggccgcgcagctcggactgaccgtgctgtccatcctcacgggctcgcaacgg
gccacggacctcgggtccaacctcagccaggtaatgtttacgctgcccaacagtcgttcg
cacgagagcgaggccgacctgatcggggtggagctggccgcgcgggcgggctatgacccg
cgtgccgctgtcacgctgtggcagaaaatgggtgcggctcagggtgcgcaggcgcctccc
gagttcctttccacccatccctcggccgccacgcgtattggcgatctgcaacaggcggcg
cagcgcgtcatgccgctatacgagcagtcgcggcgctga

DBGET integrated database retrieval system