KEGG   Kyrpidia tusciae: Btus_0151Help
Entry
Btus_0151         CDS       T01220                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bts  Kyrpidia tusciae
Brite
KEGG Orthology (KO) [BR:bts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bts03012]
    Btus_0151
   03029 Mitochondrial biogenesis [BR:bts03029]
    Btus_0151
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bts04147]
    Btus_0151
Translation factors [BR:bts03012]
 Eukaryotic Type
  Elongation factors
   Btus_0151
 Prokaryotic Type
   Btus_0151
Mitochondrial biogenesis [BR:bts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Btus_0151
Exosome [BR:bts04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Btus_0151
  Exosomal proteins of breast cancer cells
   Btus_0151
  Exosomal proteins of colorectal cancer cells
   Btus_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ADG04929
UniProt: D5WRR8
LinkDB All DBs
Position
151848..153038
Genome map
AA seq 396 aa AA seqDB search
MAKQKYERTKPHVNIGTIGHVDHGKTTLTAAITAVLAKHGRAQATKYDEIDKAPEEKERG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLNEYEFPGDDVPVIRGSALKALE
DPNGPWADKIEELMNAVDEYIPTPEREVDKPFLMPVEDVFTITGRGTVATGRVERGKVKV
GDEVEIVGLREEPKKTVVTGVEMFRKLLDEAVAGDNIGVLLRGVDRKEVERGQVLVKPGS
IKPHTKFRAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVT
MEVELISQIALEEGTRFAIREGGRTVGAGAVTAILQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacaaaagtacgagcgcaccaagccccacgtcaatatcgggacgatcggtcac
gtcgaccacggcaagaccacgctgaccgcggcgatcactgcggtcttggcgaaacacggg
cgcgcccaagccacgaagtacgatgagatcgacaaggccccggaggaaaaggaacgcggc
attaccatcaataccgctcacgtggagtatgagaccgagaagcggcactatgcccacgtg
gactgcccgggacacgcggactatgtgaagaacatgatcaccggagccgctcagatggac
ggtgccatcctggtggtgtcggcggcggatggcccgatgcctcagacccgggaacacatc
ctcctggcgcgacaggttggcgtgccctacatcgtcgtcttcctgaacaaatgcgacatg
gtggatgacgaggagctgttggaactggttgaaatggaggtccgggatctgctcaacgaa
tatgagttccccggcgatgacgtcccggtgattcggggttctgcgctcaaggcgctcgaa
gatcccaacggcccctgggcggataagatcgaagagctcatgaacgctgtcgatgaatac
attccgacccccgagcgggaagtcgacaagcccttcctgatgccggtggaagacgtgttc
acgatcaccggccgcggaacggtggccacgggcagggtcgagcgcggaaaggtcaaagtc
ggggatgaggtcgagatcgtcgggctgcgggaagagccgaagaaaactgtcgtaaccggc
gtagagatgttccggaaactgctcgatgaggcggtggccggcgataacattggcgttctg
ctgcggggtgtcgatcgcaaagaggtggagcgcggccaggtgttggtgaaacccggaagc
atcaaacctcacaccaaattccgagctcaggtctatgtcttgaccaaggaggaaggcggc
cggcacaccccgttctttaacggatatcgcccgcagttctattttcggaccacggacgtg
accggtgttgtcaaactccccgaaggcaccgagatggttatgccgggggacaacgtcacg
atggaagtggaactgattagccagatcgccctggaggaaggaacccgctttgccattcgg
gaaggcggccgaacggtgggggctggggccgtcacggcgatcctgcaataa

DBGET integrated database retrieval system