KEGG   Kyrpidia tusciae: Btus_1162Help
Entry
Btus_1162         CDS       T01220                                 

Definition
(GenBank) nitrite reductase (NAD(P)H), large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bts  Kyrpidia tusciae
Pathway
bts00910  Nitrogen metabolism
bts01100  Metabolic pathways
bts01120  Microbial metabolism in diverse environments
Module
bts_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Btus_1162
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     Btus_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Rubredoxin_C Pyr_redox NIR_SIR_ferr Pyr_redox_3 AlaDh_PNT_C GcpE
Motif
Other DBs
NCBI-ProteinID: ADG05892
UniProt: D5WXH1
LinkDB All DBs
Position
complement(1169628..1172048)
Genome map
AA seq 806 aa AA seqDB search
MSKKKLVLVGNGMAGIRCIEEILAADPEAFDIIVFGAEPHPNYNRILLSSVLAGDTRLQD
IVLNDWSWYEQHGITLYTGHPVSRIDIPNKRVCTSTGIEEPYDELILATGSLPILLPVPG
SDKEGVIAFRNIEDCRTMIEASKTYSKAVVIGGGLLGLEAARGLLHLSMDVSVVHLFDCL
MERQLDPTASKMLQAELERQGMRFLMEKQTAEILGDRRVTGVRFSDGTEEPADLVVMAVG
IRPNTALAKEAGIAVNRGIVVDDELRTSEPNVYAVGECAEHRGVVYGLVQPLYEQARVLA
LSLCGRTPAPYTGSVTATKLKVSGVDVFSAGEFLDGPDTRAVRIHDEMEGIYKKVLVRGG
KVTGAVLFGDTRETTRLVNWIREGVEVSPGDIWSLLSVPAASPSAATGSPVTGMSADEIV
CGCNGVTKGAIVHAIEEYGLKTVEEIKAATHASRSCGGCRSLVQQILESVLGSDVPSAGA
QGICPCTTLSREVLIEEIRAKHLTNVKEVMNVLGWANPDGCSKCRPALNYYLSMLWPEEH
ADDPASRFVNERLHANIQKDGTYSVVPRMYGGVTTPGELRRIAEVAEKYGVKMVKITGGQ
RIDLLGVGKQDLPRIWEDLGMPSGYAYGKAIRTVKTCVGTDFCRFGTQNSIGMGIQIEKR
FERLNTPAKVKMAVSGCPRNCAEATVKDLGVVGIEGGWEIYVGGNGGVHVRKADLLCKVI
TEEEVLEIAGAYLQYYRETAHYGERTSQWVERVGLDGIRQVILDPQQRSALVKRLEQALA
VTTDPWKTVAESPELQRLYQEIPVAP
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagaaactggtcctcgtcggcaatgggatggcgggcatccgttgcatcgag
gagatactggcggcagacccggaagctttcgatatcatcgttttcggcgccgagccgcat
cccaattacaatcggattttgttgtcttcggtactggcgggcgatacccgccttcaggac
atcgtcctcaatgactggtcctggtacgagcagcacggcattactctctacaccggtcac
ccggtcagccggatcgacatcccgaacaaacgcgtgtgtacctccacaggcatcgaagaa
ccgtacgacgaattgatcctggccacgggttcgctgccgatcctcttgccggtgccggga
tccgacaaagagggcgtgatcgccttccggaacatcgaggactgccgcaccatgatcgag
gcatccaaaacgtattccaaggcggtcgtgatcggcggaggtcttctcgggctcgaggcg
gcccgggggctcctccatttgtccatggacgtgagcgtcgttcacctcttcgattgtctg
atggaacgccagctcgatcccacagcttccaagatgctgcaggcagagctcgagaggcag
ggcatgcgctttttgatggagaaacagacggcggaaatccttggagaccgtcgcgtcacc
ggggtgcggttctccgacggcactgaagagccggccgacctggtggtcatggcggtcggc
atccgtcccaacaccgctttggccaaagaagccgggatcgcggtcaatcggggaattgtc
gtcgacgatgagctccggaccagcgagcccaacgtctatgcggtcggggaatgcgcggag
catcggggggtcgtgtacggcctggttcagccgctttacgaacaggcccgggtcttggcc
ctcagcctgtgcggccgtaccccagccccctacacgggttcggtgaccgccacgaagctc
aaagtctccggggtggatgtcttctccgccggcgagttcctggacggcccggacacccgg
gccgtgcggatccacgatgaaatggaaggtatttataaaaaggtcttggttcgcggcggc
aaagtgaccggcgcggtcctgttcggcgacacccgggaaaccacccggctggtgaactgg
atccgggaaggagtggaggtctccccgggagacatctggtcgttgctgtccgttccggca
gcttccccgtctgctgcgacgggttcccctgttaccggcatgagcgcggatgagatcgtc
tgcggatgcaacggcgtaacaaagggcgccatcgtccacgccatcgaagagtacggcctc
aaaacggtggaagaaatcaaggccgcgacccatgcttcccggtcctgcggaggatgccgt
tccctggtccagcagatcctcgaatcggtcctcgggagcgacgtcccctcagccggcgcc
caagggatctgtccctgcacgacgttgagccgggaagtgctgatcgaagagatccgggcc
aaacacctgaccaacgtgaaagaagtgatgaacgtcctcggatgggccaatcccgacggt
tgctccaaatgccggcccgccctgaattactacctcagtatgctgtggcccgaggaacac
gccgacgaccccgcttctcggttcgtcaacgagcggctccacgccaacattcaaaaagac
gggacctattcggtcgtgccccggatgtacggaggggtgacgactcccggcgagttgagg
cgcatcgccgaggtcgccgaaaaatacggtgtgaaaatggtcaaaatcacgggaggacag
cgcatcgatctgcttggagtgggtaagcaggatctgccccgcatatgggaggacttgggc
atgccctcgggctacgcttacggcaaggccatccgcaccgtcaaaacctgtgtgggaacg
gatttctgccgattcggaacccaaaactccattggcatgggcattcaaatcgagaaacga
tttgaacgcctcaacacccccgccaaagtcaaaatggccgtctccggatgcccccgaaac
tgcgccgaagccaccgtcaaggaccttggagtggtgggcattgagggcggctgggaaatc
tacgtcggcggcaacggcggggttcacgtccgaaaagcggacctgctgtgcaaggtgatc
accgaagaagaagttctggaaatcgccggcgcctatctgcagtattaccgcgaaaccgcc
cactacggcgaacgaacctctcaatgggtggaacgggtggggctggatggcattcgccag
gtgatcctcgatcctcagcaacggtcggccctcgtcaaacgactggaacaggccctggcg
gttacgacggacccgtggaagacggtggcggagagtccagaactccagcggctgtatcag
gagatccccgtcgcaccgtaa

DBGET integrated database retrieval system