KEGG   Kyrpidia tusciae: Btus_2320Help
Entry
Btus_2320         CDS       T01220                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
bts  Kyrpidia tusciae
Pathway
bts00621  Dioxin degradation
bts01100  Metabolic pathways
bts01120  Microbial metabolism in diverse environments
bts01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Btus_2320
Enzymes [BR:bts01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     Btus_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Say1_Mug180 FSH1
Motif
Other DBs
NCBI-ProteinID: ADG06989
UniProt: D5WS37
LinkDB All DBs
Position
complement(2347434..2348261)
Genome map
AA seq 275 aa AA seqDB search
MADELREDYIVANGIKTHVWETGSGETVLFVHGGGAGADAWGNWKDTLPRFAAAGFRAVA
IDMVGFGKTDKPDPATFEYSNQARIDHLIGVIQSMNVSKLNLVGNSMGGAASLGVCIQRP
ELVNKLVLLGSAGRHRPVQRSEELNAVLKYTPGREQMYKIVRGLTNPKFEVDEAMVDYRL
ALSQSPGTMEAYIGTMKWVEKNGMFYEDEELQSIPHKTLVIHGKNDRMVPIDESWEICRL
IENAWMHIIPNCGHWAMIEHPDEFCAVTLYFLKNA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgagttgagagaagactatattgtggccaacggcattaagacgcatgtgtgg
gaaacaggtagcggcgaaacggtcctcttcgtccatggtggaggagcgggtgcggacgct
tgggggaactggaaagatacgctgccccgctttgcggctgcaggatttcgtgcggtggcc
attgatatggtcgggtttggaaaaacggacaagcccgatccagctacctttgaatattcg
aaccaggccaggatcgatcatcttattggagtcattcaatctatgaacgtctccaagtta
aatctggtcggcaattcgatggggggtgcggcttcactgggggtatgcattcaacgtccg
gaactggtcaacaagttggttttattgggcagtgccggcagacaccgccctgtccagcgg
agtgaagaattaaatgcagtgctgaaatatacgcctggacgtgaacagatgtataagatt
gttcgtggtttaaccaatccaaagtttgaagtggatgaggccatggtcgattatcggctg
gcactcagtcaaagtccaggaacgatggaagcgtatattggcacgatgaagtgggtggaa
aagaacggaatgttctatgaggatgaagagttacagagtatccctcacaaaactctggtt
attcatggaaagaacgaccgcatggttcccattgatgaatcctgggagatctgcaggctg
atagagaatgcctggatgcatattatcccgaattgcggtcattgggcgatgatcgaacat
cctgatgagttctgtgccgttacgctctactttttaaagaatgcgtaa

DBGET integrated database retrieval system