KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_0457Help
Entry
HD73_0457         CDS       T02460                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Brite
KEGG Orthology (KO) [BR:btt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HD73_0457
Enzymes [BR:btt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HD73_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like GIDA K_oxygenase DAO AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AGE76037
LinkDB All DBs
Position
complement(448166..448942)
Genome map
AA seq 258 aa AA seqDB search
MRTSSDVKKTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSV
IVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIV
KHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISYIDRETEEVHH
VELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCTNNPYKQIIIS
MGSGANAALGAFDYLIRN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacttcatcagacgtaaaaaagactgaaggtcctaagctagtagcaagccttgaa
gaacacgtaaaagaatacgacatcgatgtaatgaatctacaacgtgcgaaacgtttagag
aaaaaagaacttattgaagtggaacttgaaaacggcgctattctgaaaagtaagagcgta
atcgtttctacaggtgctcgctggcgtaatgttggcgtaccaggtgaagctgagttcaaa
aataaaggtgtagcatattgcccacactgtgacggtccattattcactggaaaagacgta
gcagttatcggcggaggtaactctggtattgaagcagctatcgacttagcaggtatcgtt
aagcacgtaactgttcttgaattcatgccagaattaaaagctgatgctgtattacaagag
cgtcttaacagcttaccaaacgtaactgttctgaaaaacgttcaaacgaaagaaatcact
ggtactgataaagtaaacggtatttcttacatcgatcgtgaaactgaagaagttcatcac
gttgaattacaaggtgtattcgtacaaatcggtcttgtgccaaacacagactggttaggc
gaaacagttgaacgcgttcgcggtgaaatcgtaacagacaagcacggcgctacaaacgta
ccaggagtgtttgctgcaggtgactgtacaaataatccgtacaaacaaatcatcatctct
atgggttcaggtgcaaacgcagctttaggtgcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system