KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2309Help
Entry
HD73_2309         CDS       T02460                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00473  D-Alanine metabolism
btt01100  Metabolic pathways
btt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HD73_2309
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HD73_2309
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btt01011]
    HD73_2309
Enzymes [BR:btt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HD73_2309
Peptidoglycan biosynthesis and degradation proteins [BR:btt01011]
 Precursor biosynthesis
  Racemase
   HD73_2309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGE77887
LinkDB All DBs
Position
2187475..2188701
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKAN
GYGHGAVEVAKAAIEAGIHQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDV
MMTVYRVEDLHGINEIANRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMV
RVGIGVYGMYPSKEVDHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGYALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacataatgtaaaa
gaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgtaaaagcgaat
gggtatggccatggggcagttgaagttgccaaagctgcaattgaagcgggaatacatcaa
cttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaattactgtacca
attttaattttaggatacacaccagtagcggctgtagaagatgtaattcaatatgacgtt
atgatgactgtttatagagtagaagatttacatggtataaatgaaattgcaaaccgtctt
caaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatcggtttacaa
gaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgtagaggtagta
gggatgtttacgcattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaaataccatat
attcatagttcaaatagtgcgggatcaatggaattaagtaacacatttcaaaatatggta
cgcgttggaataggagtgtacggtatgtatccatcaaaagaagtggatcattcagtcgtt
tctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacatgcgaagaag
aatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatggattgcgact
gtaccaattggttatgctgatggttataatcgtcaattatctaataaaggctatgcgtta
attaatggggttcgagtacctgttattggccgtgtttgtatggatcagttaatgttggat
gtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggtaaacaaggt
gaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaactatgaagtt
acatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaaacaactgca
gttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system