KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_3728Help
Entry
HD73_3728         CDS       T02460                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00500  Starch and sucrose metabolism
btt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HD73_3728
Enzymes [BR:btt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HD73_3728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AGE79306
LinkDB All DBs
Position
complement(3570231..3571772)
Genome map
AA seq 513 aa AA seqDB search
MFKRITIVGLSVVMFLPSIYDGSKAYADTVNNGTLMQYFEWYAPNDGNHWNRLRTDAENL
AKKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
KNIDVYGDVVMNHKGGADYTETVTAVEVDPSNRNIEVSGDYEISAWTGFNFPGRGDSYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKKWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILKGTVVANHPTLAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTKGNSNYEIPALKDKIDPILTA
RKNFAYGTQRDYFDHPDVIGWTREGDSVHANSGLATLISDGPGGAKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFQVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaataacaatagtcggattgtcagttgttatgtttttacctagtatatat
gacgggagtaaagcatatgcagacacagttaacaatggaacgttaatgcagtattttgag
tggtatgctccgaatgatgggaatcattggaatcgtttgcgtactgatgctgaaaattta
gcgaaaaaaggaattacatctgtttggataccacctgcatataaaggaactacgcaaaat
gacgtaggatatggagcatatgatttatatgatctgggggaattcaatcaaaagggaaca
gtgcggacgaagtatgggacgaaagcacaattgaaatctgcaattgacgctttacataag
aaaaacatcgatgtatacggtgatgtagttatgaatcataaaggtggggctgattataca
gaaactgtcacagcagttgaggtagacccgagcaatcggaatattgaagtatcaggtgat
tatgaaattagtgcgtggacgggatttaactttccagggcgtggagattcttattctaat
ttcaaatggaaatggtatcattttgacggaacggattgggatgaaggaaggaaattaaac
cgaatttataaatttaggggcataggtaaagcatgggactgggaagtgtctagcgagaat
gggaattatgattatttgatgtatgcggatcttgattttgatcatccagatgttgcgaat
gaaatgaaaaaatggggaacgtggtatgcgaatgaattaaatttagatggttttcgttta
gatgctgttaaacatattgatcatgaatatttgcgcgattgggtaaatcacgttagacag
caaacagggaaagaaatgtttacagtagctgaatattggcaaaatgatatccagacttta
aataattatttagcgaaggttaattataatcaatctgtgttcgatgcaccacttcattat
aattttcattatgcttcaacaggaaatggaaattatgatatgagaaatattttaaaagga
acggtagttgcgaatcatcctacacttgcggttactctagttgaaaatcatgattcacag
cctggtcagtcattggaatctgtagtgagcccttggttcaagccgctggcatatgcattt
attttaacgcgtgcagaggggtatccttctgttttctatggtgattactatggtacaaaa
ggaaatagtaactatgaaattccagcgttaaaggacaaaattgatccgattttgacggca
cgaaaaaactttgcatatggtacgcagcgtgattattttgatcatccagatgtgattggc
tggacaagagaaggtgatagtgtacatgctaattctggtttagcaacattaatctctgat
ggaccaggaggggcaaagtggatggatgttggaaagaataacgcaggggaagtatggtac
gatattacgggtaatcaaacgaatactgtaacaattaataaggacggatgggggcagttt
caagtaagtggaggatcagtttccatatatgttcagcagtaa

DBGET integrated database retrieval system