KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4539Help
Entry
HD73_4539         CDS       T02460                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01130  Biosynthesis of antibiotics
btt01230  Biosynthesis of amino acids
Module
btt_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HD73_4539
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     HD73_4539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_17 Cytidylate_kin2 AAA_33 dNK Cytidylate_kin Thymidylate_kin AAA DUF2194 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AGE80117
LinkDB All DBs
Position
complement(4363093..4363563)
Genome map
AA seq 156 aa AA seqDB search
MGAGKTTIGKALSKELQMDVVDTDQKIEEKQEKAIRKIFAEEGEMAFREYESEMLRALPV
HNVIITTGGGIIERAENRKWMKENGTVVYLYCDPHVIAERLREDTTRPLFQKKDIDAFVK
KFESRRAYYEEAHIHIDTTNKSVKQIMNELKEKINV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagggaaaacaacaattggaaaagcgttaagtaaagaacttcaaatggatgtt
gtagatactgatcaaaaaatcgaagagaagcaagagaaggcaattcgaaaaatttttgcc
gaagaaggcgaaatggcttttcgggaatatgaaagcgaaatgttacgtgcgctaccagtc
cataatgttattattacaactggtgggggaattattgaacgagcggaaaatcgcaagtgg
atgaaagagaacggaactgtcgtgtatttatattgtgatccgcatgtaattgcagaaagg
cttcgtgaagatacgacacgtccactatttcaaaagaaagatatagatgcattcgtaaag
aaatttgaatcacgccgagcttattatgaagaggctcatattcatatcgatacgacaaat
aagtctgtaaagcaaattatgaatgaattaaaggaaaagattaatgtataa

DBGET integrated database retrieval system