KEGG   Borrelia turcica: DB313_01250Help
Entry
DB313_01250       CDS       T05670                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
btur  Borrelia turcica
Pathway
btur00564  Glycerophospholipid metabolism
btur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DB313_01250
Enzymes [BR:btur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DB313_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AYE36130
UniProt: A0A386PN05
LinkDB All DBs
Position
256998..258560
Genome map
AA seq 520 aa AA seqDB search
MSKNEEKELKDLDNQDFDLIIVGGGATGLGIAIDSITRGNKTLLIEKFDYAKGTSSRSTK
LIHGGVRYLAQFNIPLVKEALYEKALLEQNAPHLVNECAFVTPIYNIFSLPYYYFGLSWY
HNLLGKHKKAKYKTRLLSKSETIERIPNIKTEGLKCSVLYYDDSFDDARMAISMLRTFTE
KGGIAFNYTELISFTKENGKISGAVIKDKTTDTQVTIKSKCIINATGIFADEIRKIDDPS
APNIIRPSQGTHLILKKDKFHTDYAMLMPKTSDNRVLFALPWHDGVVCGSTDVSIDKIEE
EPKSLESEIEFIIDNMNDYLNTKISKSDVKSAYAGIRPLIVDPKGEQNTSKISRDEKIFI
SESNLITIAGGKYTTFRKMAEKTLKRAIEEKLISDSISTTENLKLHGYLEKEKVLNIPEP
FRVYGSDFKILSEMEGFNNKIHADLSLNEAQITFAIEFEQAKTVEDILSRRTRSLLLNAK
ATIEATPKVAEIMMQKLGKSEEWKNDQIKTFTETAQKYLV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatgaagaaaaagaactaaaagatcttgataatcaagattttgacctaata
atagttggtgggggagcaacaggcctgggcatcgcaatagattccattacaagagggaat
aagactttgcttattgaaaaatttgactatgcaaaaggtacatcctctagatcaaccaag
ctaatacatggtggtgtaagatatttagctcaatttaatatacccttagtaaaagaagca
ctttatgagaaagcattactcgaacaaaatgcccctcatttagtgaatgaatgcgctttt
gttacgcctatatataacatttttagcctaccctactactattttggactaagttggtat
cataaccttcttggaaagcataaaaaagctaagtacaaaacaagattattatcaaaatcc
gagacaatagagagaattccaaatattaaaacagagggtcttaaatgttccgtgctctat
tatgatgattcttttgatgatgccagaatggcaataagtatgcttagaacttttaccgaa
aaaggtgggattgcattcaattatacagaacttataagttttactaaagagaatggtaaa
atatcaggggctgttattaaagataaaacaactgatacacaagttactataaagagtaaa
tgcataataaatgcaacagggatttttgcagacgagattagaaaaatagatgaccctagt
gcccctaacattattagaccttctcaaggaacacatctaatacttaagaaagataaattt
catacagactatgcaatgcttatgcctaagacaagtgataatagagtcttattcgcacta
ccttggcacgatggagttgtttgtggaagcacagatgtttcaatagataaaattgaagaa
gagcctaagagcctagaaagtgaaattgaattcataatagacaatatgaacgattattta
aatactaaaataagtaagagtgatgttaagagcgcttatgcaggtattagaccactaata
gtagatcctaaaggagagcaaaacacctcaaaaatatcaagagatgagaaaatatttatc
tcagaatcaaatcttattacaattgccgggggtaaatacaccactttcagaaaaatggcc
gaaaagactctaaaaagagcaatagaagaaaaattaatatctgactcaatctctactaca
gaaaacttaaagttgcacggttacttagaaaaggaaaaagtactcaatattcctgaaccc
tttagagtctatggaagtgattttaaaattttaagtgaaatggaaggatttaataataag
attcatgctgatttatcattaaatgaagctcaaatcacctttgctattgaatttgaacaa
gcaaaaactgtagaagatattttatcaagaagaacaagatcacttctattaaatgcaaaa
gccacaattgaagctacaccaaaggttgctgagattatgatgcaaaaacttggcaaatct
gaagaatggaagaatgatcaaataaaaacctttacagagacagcgcaaaaatatttagtt
taa

DBGET integrated database retrieval system