KEGG   Burkholderia thailandensis MSMB59: BTHA_1669Help
Entry
BTHA_1669         CDS       T03416                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00010  Glycolysis / Gluconeogenesis
btv00020  Citrate cycle (TCA cycle)
btv00620  Pyruvate metabolism
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
btv01200  Carbon metabolism
Module
btv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTHA_1669 (aceF)
   00020 Citrate cycle (TCA cycle)
    BTHA_1669 (aceF)
   00620 Pyruvate metabolism
    BTHA_1669 (aceF)
Enzymes [BR:btv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BTHA_1669 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA
Motif
Other DBs
NCBI-ProteinID: AIS94047
LinkDB All DBs
Position
1:1817493..1819139
Genome map
AA seq 548 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAGRPAQANGAAASAAQPAAAPVAAAPAPVAAGGGTVDV
RVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGAAAASAPQAAAPAQAAPAPAAAPAPAPQAAPAPQAAPAAAPAPAAS
GEYRPSHASPSVRKFARELGVDVSRVAGTGPKNRITKDDVTAFVKGVMTGQRAAPAAAAP
AGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITDLE
ALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADT
PNGLVVPVIRDADKKGLVEIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFT
PIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALL
GDFRRIIL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaggtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gagtccgacaaggcgacgatggacgtgccgagcccgtcggcgggcacggtgaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggttcgctgatcgtgctgctcgacggcgcg
caggcggcgggcaggcccgcgcaggcgaacggcgccgcggcgagcgccgctcagccggcg
gccgcgcccgttgccgccgcgcctgcgcctgtggcggcgggcggcggcacggtcgacgtg
agggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgagtccgacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtgggcgacgcg
gtgtcggaaggctcgctgatcgtcgtgctcgaggcgtcgggcgccgccgccgcgagcgcg
ccgcaggccgccgcgcccgctcaggccgcgcccgctcccgcggctgcaccggcacccgcg
cctcaggctgcacccgcgccgcaggcggcgcccgcagccgcgcctgcgcccgccgcgagc
ggcgagtaccgcccgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgaactcggt
gtcgacgtgtcgcgcgtcgcgggcacggggccgaagaaccgcatcacgaaggacgacgtc
accgcgttcgtgaagggcgtgatgacggggcagagggcggcgcccgccgcggcggcgccg
gcaggcggcggcgagctgaatctgctgccgtggccgaaggtcgatttctcgaagttcggc
ccgttcgaggcgaagccgctgtcgcggatcaagaagatctcgggcgcgaacctgcatcgc
aactgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgatctcgag
gcgctgcgcgtgcaactgaacaaagagcacgagaaggcgggcgtgaagttcacgatgctc
gcgttcgtgatcaaggcggtggtggcggcgctcaagaaattcccgaccttcaacgcgagc
ctcgacggcgacaacctcgtcttcaagcagtactaccacatcggtttcgcggccgacacg
ccgaacggcctcgtcgtgccggtgatccgcgatgcggacaagaaggggctcgtcgagatc
gcgaaggaaatggccgagttgtcgaaggccgcgcgcgaaggcaagctgaagccggaccag
atgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacg
ccgatcatcaacgcgccggaagtggcgatcctcgggttgtcgcgcggccagatgaagccg
gtgtgggacggcaagcagttcgtgccgcgcctcacgctgccgctgtcgctgtcgtatgac
catcgcgtgatcgacggcgcggaagccgcgcggttcaatgcgtatctcggggcgttgctc
ggggatttccgccgcatcattctttga

DBGET integrated database retrieval system