KEGG   Burkholderia thailandensis MSMB59: BTHA_1850Help
Entry
BTHA_1850         CDS       T03416                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00480  Glutathione metabolism
btv00590  Arachidonic acid metabolism
btv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BTHA_1850
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTHA_1850
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BTHA_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AIS94341
LinkDB All DBs
Position
1:2009851..2010330
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLAVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFAKIDVNGANAHPLYRYLTEESPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcggggggcgaggtgccgctcgag
cagtaccggggcaaggtgcttctcatcgtcaacacggcgagcgagtgcggattcacgccg
cagtacgcggggctgcagcagctgtacgatcgctttcgcgaacgcgggctcgccgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccgggcgacgcgtcgcagatcggcgcg
ttttgcgagaagaactacggcgtcacgtttccgatgttcgcgaagatcgacgtgaacggt
gcgaacgcgcatccgctgtaccggtatctgaccgaagagtcgcccggcattctcggcctc
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggagggcgagatcgtgaag
cgctacgcgccatcgacgaagcccgaggatatcgccgcggacgtcgaaaagctgctttga

DBGET integrated database retrieval system