KEGG   Burkholderia thailandensis MSMB59: BTHA_3162Help
Entry
BTHA_3162         CDS       T03416                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00020  Citrate cycle (TCA cycle)
btv00480  Glutathione metabolism
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
btv01200  Carbon metabolism
btv01210  2-Oxocarboxylic acid metabolism
btv01230  Biosynthesis of amino acids
Module
btv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTHA_3162 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTHA_3162 (icd)
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BTHA_3162 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIS97130
LinkDB All DBs
Position
1:complement(3474244..3475503)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GTFRDAGYALAQKEFGAVLIDGGPWMKFKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccctacatcgagggcgacggcacgggc
ttcgatatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggtccggacgtgtggctgccggaagagacgctgcaggtgctgaaggagtacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtctgcctgcgcccgattcagtacttcaagggcgttccc
tcgcccgtgcgcgagccggagaagaccaacatggtgatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcacgttccgtgacgccggctatgcgctcgcccagaaggagttcggcgcggtgctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgatgcgttcctgcagcagatcctgctgcgcccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgcttgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcaggcaaggactacgtgaacccgggttcggaaatcctg
tccgccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtcatcatcgcc
gcgatggaaaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system