KEGG   Burkholderia thailandensis MSMB59: BTHA_3976Help
Entry
BTHA_3976         CDS       T03416                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00040  Pentose and glucuronate interconversions
btv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTHA_3976
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BTHA_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AIS97954
LinkDB All DBs
Position
2:516658..517692
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARDLALRDIDLPLEVGPADVKIRIHTVGVCGSDVHYYTHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTHLRAGDRVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPQNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFASNRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNAKAYAGIVDLLCPNGCLVLVGMPLEPVPLDVVALQAKEARIESVFRYANVFPRALA
LIESGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgatctcgcgctgcgcgacatcgacctgccg
ctcgaggtcggccccgccgacgtcaagatccgcatccacacggtgggcgtctgcggcagc
gacgtccactattacacgcacggcgggatcggcccgttccgggtcgacgcgccgatggtg
ctcggccacgaggcgtccggcacggtcgtcgaggtcgggcgcgacgtcacgcacctgcgc
gcgggcgaccgcgtctgcatggaacccggcgtcccgcgcttcgattcgaaggcgacactg
cacggcctctacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcatccggcggcgttcacgtaccggctgccgcagaacgtg
tcgttcgccgagggcgcgattgtcgagccgctcgcgatcgggctgcaggccgcgaagaaa
gcggcgatgaagccgggcgacatcgcggtcgtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgattctggccgacgtcgtcaag
gagaagctcgcgctgttcgcgtcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgacgcggtcgcgcacgcgaccgacggctggggcgcggacgtcgtgttcgag
gcgagcggcaacgcgaaggcctatgcgggaatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgaaccggtgccgctcgacgtcgtcgcgctgcaggcg
aaggaggcgcggatcgaatcggtgttccgctacgcgaacgtctttccgcgcgcgctcgcg
ctgatcgaatccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system