KEGG   Burkholderia thailandensis MSMB59: BTHA_4430Help
Entry
BTHA_4430         CDS       T03416                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00020  Citrate cycle (TCA cycle)
btv00190  Oxidative phosphorylation
btv00650  Butanoate metabolism
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
btv01200  Carbon metabolism
Module
btv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTHA_4430
   00650 Butanoate metabolism
    BTHA_4430
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTHA_4430
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTHA_4430
    1.3.5.4  fumarate reductase (quinol)
     BTHA_4430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: AIS98790
LinkDB All DBs
Position
2:complement(1080085..1080786)
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEIYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKSVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIND
EPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcatttttgaaatctaccgctacgatccggacaaggacgccgcgccgcgc
atgcagacgtacgagctggagatccagcacgagcggatgctgctcgatgcgctcgtcaag
ctgaagtcggtcgacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggcctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgtccgctgccgggcctgcccgtcgtgcgcgacctgatc
tgcgatttcacgcagttcttcaaccagtaccactcgatccgtccgtacctgatcaacgac
gagccgccgcccgagaaggagcgcctgcagtcgccggaagagcgcgatgagctcgacggc
ctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggcgggcctgctgcaggcgtatcgcttcatcgcggacagc
cgcgatcgcgcgacgggcgagcgcctcgacaacctcgacgatccgtaccgtctgttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaattgatggttcgccgcacggtctga

DBGET integrated database retrieval system