KEGG   Burkholderia thailandensis MSMB59: BTHA_5089Help
Entry
BTHA_5089         CDS       T03416                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00260  Glycine, serine and threonine metabolism
btv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTHA_5089 (tdh)
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BTHA_5089 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIS98924
LinkDB All DBs
Structure
PDB: 

Position
2:complement(1845684..1846715)
Genome map
AA seq 343 aa AA seqDB search
MKALAKLERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGA
FAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLVGEDVLITGAGPIGVMAV
AIAKHVGARNVVITDINDYRLDLARRMGATRAVNVSRESLRDVMADLHMTEGFDVGLEMS
GVPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVA
MLQSGLDLSPIITHRFAVDDYEKGFAAMLSGESGKVILDWAAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgcaaagctcgaacgcggaccgggcctcacgcttacccgcgtgaagaag
cccgaggtcggccacaacgacgtcctcatcaagatccgccgcaccgcgatctgcggcacc
gacatccatatctggaagtgggacgactgggcgcagaagacgattccggtgccgatgcac
gtcggccacgagtacgtcggcgagatcgtcgagatgggccaggaggtgcgcggcttctcg
atcggcgaccgcgtgtccggagaagggcacatcacgtgcggcttctgccgcaactgccgc
gcggggcggcgtcacctgtgccgcaatacggtcggcgtcggcgtgaatcgcgaaggcgcg
ttcgccgagtacctcgcgatacccgcgttcaacgcgttcaagattccgcccgaaatctcc
gacgatctcgccgcgatcttcgatccgttcggcaacgcgacgcacactgcgctgtcgttc
aacctcgtcggcgaggacgtgctgatcacgggcgcggggccgatcggcgtgatggcggtg
gcgatcgcgaagcacgtcggcgcgcgcaacgtcgtcatcaccgacatcaacgactatcgc
ctcgaccttgcccgcaggatgggtgcgacgcgcgcggtgaacgtgtcgcgcgaatcgctg
cgcgacgtgatggcggacctgcacatgacggagggcttcgacgtcgggctcgagatgtcg
ggcgtgccgagcgcgttcacgtcgctgctcgaatcgatgaatcacggcggcaaggttgcg
ctgctcgggattccgcccgcgcaaaccgcgatcgactggaaccaggtgatcttcaagggc
ctggagatcaagggcatctacgggcgcgagatgttcgagacctggtacaagatggtcgcg
atgctgcaaagcgggctcgatctttcgccgatcatcacgcaccgcttcgccgtggacgac
tacgagaagggcttcgctgcgatgctgtcgggcgaaagcggcaaggtgattctcgactgg
gccgctgcgtga

DBGET integrated database retrieval system