KEGG   Burkholderia thailandensis MSMB59: BTHA_5533Help
Entry
BTHA_5533         CDS       T03416                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btv  Burkholderia thailandensis MSMB59
Brite
KEGG Orthology (KO) [BR:btv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTHA_5533 (ahpF)
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BTHA_5533 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Glutaredoxin DAO FAD_binding_3 HI0933_like Thi4 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AIS98465
LinkDB All DBs
Position
2:complement(2408850..2410457)
Genome map
AA seq 535 aa AA seqDB search
MLDANLKTQLKSYLERITRPVELVASLDDGDKSRELRALLDEIASLSPQVFVVERRDEAE
RAPSFSVGEPGEAARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDATIEQIRALDGDYT
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVDARRIMAVPTIFLNGET
FGQGRSSVREILAKLDSGASRRAAQALAAKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVTETEGPKFATALEQHVKQYEVDVIDVQRADRLVPGSLHE
IRLASGAVLKAKAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVTVLTHARTTELAGDGARL
NALVYEDMRTGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSDADAVQPADADAPASAEVVAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgccaatctcaagactcagttgaaatcgtaccttgaacggatcacgcgtccc
gtcgagctcgtcgcatcgctcgacgacggcgacaagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcgtcgctgtcgccgcaagttttcgtcgtcgagcgccgcgacgaggccgag
cgcgcgccgtcgttctcggtcggcgagccgggcgaagccgcgcgcattcgcttcgccggg
ataccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaaacgggcggccat
ccggtgaagctcgacgacgcgacgatcgagcaaattcgcgcgctcgacggcgactacacg
ttcgagacgtatatctcgctcacctgtcagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggtgcgttgttccag
gacgaagtcgacgcgcgccggatcatggccgtgccgacgatcttcctgaatggcgagacg
ttcggccagggccgcagcagcgtgagggaaatcctcgcgaagctcgatagcggcgcgagc
cggcgcgcggcgcaggcgctcgcggcaaagcccgtgttcgacatgctgatcgtcggcggc
ggccccgccggcgcggccgccgcgatctacgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaatttcgtgtcg
gtgacggaaaccgaagggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gaagtcgacgtgatcgacgtgcagcgcgccgaccggctcgtgccgggcagtctccatgaa
atccgtctcgcgagcggcgcggtgctgaaagcgaaggccgtcgtgctcgccacgggcgcg
cgctggcgggagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgcttttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggcggcgatcgatctcgccggcatcgtcagtgaagtgacgctgatc
gaatacggcgcgcaactgcgcgcggacgaggtgctgcaacgcaagctgcgcagcctcccg
aacgtgacggtgctcacgcacgcgcgcacgaccgagctcgcgggcgacggcgcgaggctc
aacgcgctcgtctacgaggacatgcgcacgggcgaaacgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggaacggtcgagctg
tcgaaacacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggggtgttc
gccgccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcgtcgctcggcgcgttcgactacctgatccgaagcgacgcggatgcggtgcag
ccggcggacgccgacgccccggcaagcgccgaagtggtggccgcctga

DBGET integrated database retrieval system