KEGG   Burkholderia thailandensis MSMB59: BTHA_5553Help
Entry
BTHA_5553         CDS       T03416                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00440  Phosphonate and phosphinate metabolism
btv01100  Metabolic pathways
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTHA_5553 (aepX)
Enzymes [BR:btv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTHA_5553 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD
Motif
Other DBs
NCBI-ProteinID: AIS98793
LinkDB All DBs
Position
2:complement(2436084..2437772)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSQSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ADAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDAFRQAGISTV
IWANHLIRASASAMQAVAREIQESETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGNGLEAVTGDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKVHLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLKARDDFDSLDLPALLNALVDAGERIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNTGNGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagccagtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtggtggacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctggggaatggacgaggcgctgcgccgc
gcggacgcttacgcggaagcgggtgccgacgcgatcctgattcacagcaagctgtcgcgg
cccgacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgcattccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcatccgcttccgcgatgcaggcggtcgcgcgcgaa
atccaggaaagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcggatctacctgtcgtcgagc
tcgcgcgcgtcgaacgcggcgctcgtgctcgcggcgagccgcggcaacgggctcgaggcc
gtcaccggggacaagccgaaggtgatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggttatcgc
gccgatgcgatcgacacgtccggcgtgaaactcgtcgtcaacgagcggcacgcgcaaacc
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctcacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgacctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcctcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaagtgcatttgcgccgc
gtgtcgagcgatgcgagcgaagccgcgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggcacgctgaaggcgcgcgacgat
ttcgattcgctcgatctgccggccctcctgaacgcgctcgtcgacgcgggcgagcggatc
gaggtgcaatacgtgcacggccactggcgaggcgtcaacgatctcgacgatttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacacgggcaacgggggc
gcgcgatga

DBGET integrated database retrieval system