KEGG   Burkholderia thailandensis MSMB59: BTHA_900Help
Entry
BTHA_900          CDS       T03416                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00550  Peptidoglycan biosynthesis
btv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTHA_900
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BTHA_900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btv01011]
    BTHA_900
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:btv03036]
    BTHA_900
Enzymes [BR:btv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTHA_900
Peptidoglycan biosynthesis and degradation proteins [BR:btv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BTHA_900
Chromosome and associated proteins [BR:btv03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BTHA_900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AIS93836
LinkDB All DBs
Position
1:965439..967283
Genome map
AA seq 614 aa AA seqDB search
MKPASKHTQGVKFASSPVLPVHLPMWRSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQ
GESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPADVPDDLGADKLDALGKLLGM
TTKELKAKLSEDKSFVYVKRQVPLDVAAEVAKLDIPGIYQRNEYKRFYPEGEITAHLIGF
TNVEDEGQEGVELADQKLLVGTPGSRHVIKDRVGHIVEDVDAQVPPHNGTDVDLSIDSKI
QYITYTNLKDAVEKFHAKAGAAMVVDVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLT
DVFEPGSIMKPFTVSLALDLHRVTPNTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQK
SSNIGATKIAMTMKPEEMWNMYTGIGLGQAPKVGFPGAAAGRLRPWKSWRRIEQATMSYG
YGLSVSLFQLARAYTAIAHDGELMPVTIFKTNDAQPATGPRIFSPTTAREVRTMLESVVS
PQGTSPNAAVPGYRVGGKSGTAYKQVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPT
VGGHFGGQVSGPVFSAIVGDTLRALNVPPNMPVKQLVVSDDTANAAAAQKLAANAPAKHM
IVSSTTHNRPGVVR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcttcaaagcacacgcaaggcgtgaagttcgcctcgagcccggtgctgccg
gtccatctgccgatgtggcgctcgaagctcgtcgtgttcatgctgttcatcgcgttcgtc
gcgctcgcgatgcgcgcgttctggattcagggcccgggcaacgcgttctatcagaagcag
ggcgaaagccgctatcagcgcaccctcgaattgccggcgacgcgcggcaagatcctcgat
cgcaacggcctcgtgctcgcgacgagcctgcccgtgcgcgcgatctgggcgattcccgcc
gacgtgcccgacgatctcggcgcggacaagctcgacgcgctcggcaaattgctcggaatg
acgacgaaggagctgaaggcgaagctgtcggaagacaagtcgttcgtctacgtgaagcgc
caggtgccgctcgacgtggccgccgaggtcgcgaagctcgacatcccgggcatctatcag
cgcaacgaatacaagcgcttctatccggaaggcgagatcaccgcgcacctgatcggcttc
acgaacgtcgaggacgaagggcaggagggcgtcgagctcgccgaccagaagctgctcgtc
ggcacgccgggcagccgccacgtgatcaaggaccgggtcggccatatcgtcgaggacgtc
gatgcgcaggtgccgccgcacaacggcaccgacgtcgacctgtcgatcgacagcaagatc
cagtacatcacgtatacgaacctgaaggatgcggtcgagaagttccacgcgaaagcaggc
gcggcgatggtggtcgacgtgcagacgggcgaggtgttgtcgctcgtcaattatccgacg
tacaacccgaacgaccgctcgcacctgacgggcgagcaactgcgcaaccgcgtgctgacc
gatgtgttcgagccgggctcgatcatgaagccgtttacggtgtcgctcgcgctcgacttg
catcgcgtgacgccgaacacgctcgtcgagacgggtaacggccatttcgtgctcgacggc
gcgccgatcaccgacgattcgggcttcggcacgctgaccgtcggcggcgtgatccagaaa
tcgagcaatatcggcgcgacgaagatcgcgatgacgatgaagcccgaggaaatgtggaat
atgtatacgggcattgggctcgggcaggcgccgaaggttggctttcccggcgcggcggcg
ggccggctgcgtccgtggaagagctggcggcgcatcgagcaggcgacgatgtcgtacggc
tacggcctgtcggtgtcgctgttccagcttgcgcgcgcgtacaccgcgatcgcgcacgac
ggcgagctgatgcccgtgacgatcttcaagacgaacgacgcgcagcccgcgaccgggccg
cgcatcttctcgccgacgacggctcgtgaagtgcgcacgatgctcgaatccgtcgtgtcg
ccgcagggtacgtcgccgaatgcggcggtgcccggctaccgcgtcggcggcaagagcggc
actgcttacaagcaggtcggccgcggctatgatcacaagaagtatcgtgcgtcgttcgtc
gggatggcgccgatgccgaatccgcgcatcgtcgtcgccgtgtcggtcgacgagccgacg
gtgggcggccacttcggcggccaggtgtcaggccccgtgttctccgcgatcgtcggcgat
acgctgcgcgcgctgaatgtaccgcccaacatgccggtcaagcagctcgtcgtgtctgac
gatacggcgaacgccgccgctgcgcagaagctggccgcgaatgcgccggcgaaacacatg
atcgtgtcgagcacgacacacaaccgtcctggagtagttcgatga

DBGET integrated database retrieval system