KEGG   Burkholderia thailandensis MSMB59: BTHA_908Help
Entry
BTHA_908          CDS       T03416                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00473  D-Alanine metabolism
btv00550  Peptidoglycan biosynthesis
btv01100  Metabolic pathways
btv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTHA_908
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTHA_908
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BTHA_908
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btv01011]
    BTHA_908
Enzymes [BR:btv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTHA_908
Peptidoglycan biosynthesis and degradation proteins [BR:btv01011]
 Precursor biosynthesis
  Amino acid ligase
   BTHA_908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AIS97106
LinkDB All DBs
Position
1:976736..977674
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGESAERDVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAKDIVAKLGMPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIKIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggaatcc
gccgagcgcgatgtgtcgctgaactccggccggctggtgctgcagggcttgcgcgacgca
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgttgcacggcggttacggcgagaacggtcagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggggacgactacgcggcgcgcgcgaaggacatcgtcgcgaag
ctcggcatgccgctcttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgccgat
ctcgatttgccgctcatcaagatcgtgcctgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatatctgattccgtgcggcctggatgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggattgggggcgc
gcggatttcatgctcgatgccgcaggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtcggcatcagctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system