KEGG   Bacillus thuringiensis HD1011: BF38_1636
Entry
BF38_1636         CDS       T03675                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase family protein
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
btw  Bacillus thuringiensis HD1011
Brite
KEGG Orthology (KO) [BR:btw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BF38_1636
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     BF38_1636
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     BF38_1636
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox DAO GIDA FAD_binding_2 K_oxygenase NAD_binding_8 Thi4 FAD_oxidored FMO-like Amino_oxidase YqaJ
Other DBs
NCBI-ProteinID: AJG78410
UniProt: A0A0B6BLT3
LinkDB
Position
1563994..1565043
AA seq 349 aa
MNREELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGKIHVYPEKMIWDIGGLL
PVTGEKLIEQLVQQGLTFQPEVVLNTKIESIIRNKDGIFTLKTSTGEEHFSKTVIVATGS
GILNPQKLSIEGAERFEVSNLNYTVKSLKRFKNKTVIISGGGNSAIDWANELEPIAKKVY
LTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEAIEYVELTNHETGEVSQLA
IDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHL
IAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRNRELIKQMMK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaatcgagaagaattgtttgatgtaactgtgataggcggaggacctgcagggctttat
tcagctttttatagtggactcagagaaatgaaaacaaaaataatagaatttcaaccacag
ttaggtgggaaaatacatgtttatccggagaaaatgatttgggatattggcggattatta
ccggttactggcgaaaagttaattgagcaacttgtacaacaagggttaacatttcagcca
gaagttgtattgaatacaaaaatagaatcaattattcgtaataaagatggtatttttacg
ttaaaaacaagcactggagaagaacacttttcaaaaacagtgatcgttgcaactggaagt
ggtatattgaatccacaaaagttatcaattgaaggtgcggagcgatttgaagtatcgaac
ttaaattatacagttaaatcgttaaaacgtttcaaaaataaaacggtcattatttcaggc
ggaggtaactctgcaattgattgggcaaatgagttagaaccaattgcgaaaaaagtctat
ttaacatatagaaaagaagaattatcggggcatgaggcacaagtaaaacaacttatgaac
agttctgcagaatgtttctttaatacatcgattacaacattaattgctggcgataaccat
gaagcgattgaatatgtagaattaacaaatcacgaaacgggagaggtttctcagttagct
atcgatgaagttattattaatcatggatatgaacgtgacattacattattagaaaatagt
gagttagacgttgcgattatagataattattatattgcaggtaatgcaaatagtgaatct
tcagtagacggattatatgctgctggggatattttaaagcatgaaggaaaattacactta
attgcgggagcattccaagatgctggaaatgctgtaaataaagcgaaacaatttattcaa
ccagatgcaagtgagtatggaatggtttcttcgcataatgaagtatttaagaagagaaat
cgtgaattgattaagcagatgatgaaataa

DBGET integrated database retrieval system