KEGG   Bacillus thuringiensis HD1011: BF38_1848Help
Entry
BF38_1848         CDS       T03675                                 

Gene name
npr
Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btw  Bacillus thuringiensis HD1011
Brite
KEGG Orthology (KO) [BR:btw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btw01002]
    BF38_1848 (npr)
Enzymes [BR:btw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BF38_1848 (npr)
Peptidases [BR:btw01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BF38_1848 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AJG77983
UniProt: A0A0B5P0J1
LinkDB All DBs
Position
1779592..1781292
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFVSGDLTEATGKKA
ETVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQDNTRGATIFTYDAKNRTTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIYYRANTQYFTQSTTFSQARAGLVQ
AAADLYGASSAEVAAVKQSYSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcttttgcagattctaaaaatgtgctctctacgaagaagtacaatgag
acagtacagtcaccggagtttgtttctggggatttaactgaagcaactggtaagaaagca
gaaactgttgtgtttgattacttaaacgcggcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtatatgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttctttaaaagtattatctggaacagttgcacctgatttagac
aaaaaagaaaagttgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttaggtgttacacctaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatacgttgtaaatttaaacttcttagagccg
agcccaggaaactactactatttcattgaagcagacagtggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataaatcaccagttaagcaagaggcacctaaa
caggaagcgaaaccagctgtaaagcctgtaacaggaacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaaatcgcttaatacaacgttatctgcatcatcttactattta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaaccgaactacatta
ccgggaacgttatgggtagatgcggataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcattactatgcaggtaaaacatatgattattataaagctacttttaataga
aactctattaatgatgcaggagcaccattaaaatcgacagttcattacggaagtaagtat
aataatgcgttctggaacggctcacaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaattggccatgaattaacgcatgctgttacagag
tatagctcagatttaatttatcaaaatgaatcaggagcattaaatgaagctatttcagat
gtatttggtacattagtagagtattatgataaccgtaaccctgattgggaaattggtgaa
gatatttacacgcctggtaaagctggagatgcacttcgctctatgagtgatccaacaaaa
tatggtgatccagatcattattctaagcgttacacaggcactagtgataacggtggcgtt
catacaaatagcggtattattaacaaagcggcttacttactagcgaatggtggtacgcat
tacggtgttactgtgaacggtattggtaaagataaagtaggagcgatttattaccgtgca
aatacgcaatatttcacgcaatctactacttttagtcaagctcgtgctggattagtacaa
gctgcagctgacttatatggtgctagctctgcagaagtagcagcagttaagcaatcatat
agtgctgttggcgtaaactaa

DBGET integrated database retrieval system