KEGG   Bacillus thuringiensis HD1011: BF38_2477
Entry
BF38_2477         CDS       T03675                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase family protein
Organism
btw  Bacillus thuringiensis HD1011
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Pyr_redox_dim HI0933_like DAO NAD_binding_8 FAD_oxidored K_oxygenase Lycopene_cycl 3HCDH_N FAD_binding_2 Thi4 TrkA_N AlaDh_PNT_C NAD_binding_7 FAD_binding_3 GIDA NAD_Gly3P_dh_N ELFV_dehydrog 2-Hacid_dh_C ApbA F420_oxidored
Other DBs
NCBI-ProteinID: AJG75361
UniProt: A0A0B6BPL1
LinkDB
Position
2389098..2390432
AA seq 444 aa
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIA
RNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPE
WEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIE
RNDHIGTIYDGDMAEYIHKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLV
SVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIG
TTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVD
STNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLED
VDLSYAPPYNSVWDPIQQAARRAE
NT seq 1335 nt   +upstreamnt  +downstreamnt
gtgaactatgtcattattggcggagatgcagctggtatgagtgcagctatgcaaattgtt
agaaacgatgaaaatgcaaatgttgtgacgctagaaaaaggtgaaatttattcgtatgcg
cagtgtgggttaccgtatgtcattagtggtgctatcgcttcaacggaaaagttaatcgcg
cgtaatgtaaagacgtttcgtgataaatacggaattgatgcgaaagtacgacatgaagta
acgaaagtagatacggaaaagaaaatagtatacgcagagcatacgaagacgaaagatgtt
tttgaattttcgtatgaccgtttattaattgcgaccggagtacgtcctgttatgccagaa
tgggaagggcgagatttacaaggcgttcatcttttaaaaacaatcccagatgctgagcgc
atattaaaaacactagaaacgaataaagttgaggatgtaactattattggcggtggtgca
attgggctggaaatggcagaaacattcgtcgaacttggtaagaaagtaagaatgattgag
cgaaatgatcatatcggtacgatttatgatggggatatggcggagtatatacataaagag
gcagataaacatcatattgaaattttaacgaatgaaaatgtaaaagcgtttaaagggaat
gaacgagtagaagcagttgaaacggataaaggtacgtataaagcggatcttgttttagta
tctgtcggagtgaagccgaatactgattttcttgaaggaacgaatatacgtacaaatcat
aaaggggcaatcgaggtaaatgcatatatgcaaacgaatgtgcaagacgtatatgcagct
ggtgattgtgcgacacattatcacgtgataaaagaaattcatgatcatattccaattgga
acaactgcaaataaacaagggcgacttgctggactgaatatgctagataaacgaagagct
tttaaaggaacgttaggtacaggcattattaaatttatgaatttgacgctcgcaagaaca
ggcttaaatgaaaaagaagcaaaaggactacatatcccgtataaaacagtcaaagtagat
tcgactaatatggcgggctattatccaaatgcgaaaccactttacttgaaattactatac
cgttctgacacgaaacaattattaggtggacaagtaattggagaagaaggtgtagataaa
cggattgatgtaatcgcaatggcactcttcaataaaatgagcattcacgatttagaagat
gtggacttaagttatgcaccaccatataacagcgtttgggatccaattcagcaagcggca
aggcgagcggaatag

DBGET integrated database retrieval system