KEGG   Bacillus thuringiensis HD1011: BF38_2505Help
Entry
BF38_2505         CDS       T03675                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00010  Glycolysis / Gluconeogenesis
btw00053  Ascorbate and aldarate metabolism
btw00071  Fatty acid degradation
btw00280  Valine, leucine and isoleucine degradation
btw00310  Lysine degradation
btw00330  Arginine and proline metabolism
btw00340  Histidine metabolism
btw00380  Tryptophan metabolism
btw00410  beta-Alanine metabolism
btw00561  Glycerolipid metabolism
btw00620  Pyruvate metabolism
btw00625  Chloroalkane and chloroalkene degradation
btw01100  Metabolic pathways
btw01110  Biosynthesis of secondary metabolites
btw01120  Microbial metabolism in diverse environments
btw01130  Biosynthesis of antibiotics
Module
btw_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:btw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF38_2505
   00053 Ascorbate and aldarate metabolism
    BF38_2505
   00620 Pyruvate metabolism
    BF38_2505
  Lipid metabolism
   00071 Fatty acid degradation
    BF38_2505
   00561 Glycerolipid metabolism
    BF38_2505
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BF38_2505
   00310 Lysine degradation
    BF38_2505
   00330 Arginine and proline metabolism
    BF38_2505
   00340 Histidine metabolism
    BF38_2505
   00380 Tryptophan metabolism
    BF38_2505
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BF38_2505
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BF38_2505
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BF38_2505
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BF38_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC FANCI_HD1
Motif
Other DBs
NCBI-ProteinID: AJG78211
UniProt: A0A0B5NW63
LinkDB All DBs
Position
2416711..2418078
Genome map
AA seq 455 aa AA seqDB search
MSVSSIVNKQKAYFYNGHTRSVEVRKNNLKKLYEGIQRFEEEIFQALKLDLNKSVHESFT
TEVGYVLKEISFQLKHISSWSKPKRVRTALTHFGSKGKVVPEPYGVTLIIAPWNYPFQLA
IAPLVGALAAGNTIVLKPSELTPNVSKVITRMLAELFQEELVAVVEGGVEESTALLKEPF
DYIFFTGSVGVGKVVMEAAAKQLTPLTLELGGKSPCIVHKDAKVDVTARRIVWGKFLNAG
QTCVAPDYLYVHASVKEQLIEALRHEIAEQYGNEPLQNENYVRIVSERHFERLCRFLQDG
QVAIGGNYKRDTLHIEPTVVKDITWQDAVMEDEIFGPILPIIEYENIEEVIDTIQQHPKP
LALYVFSEDKEMQKKVTSNISYGGGCVNDVVYHLATPYLPFGGVGSSGLGSYHGEESFRT
FSHYKSILAQSTAFDMKIRYSSTKSALKFIRKLLK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcttctattgtaaataaacaaaaggcatatttttataatggccatacgaga
agtgtagaagtgagaaagaataatttgaagaagctttatgaaggcattcagcgctttgaa
gaagaaatatttcaggcattgaaattagatttaaataagtcagttcacgagtcatttaca
acggaagtgggatatgtgttaaaagaaatttcttttcaattgaagcatatttcatcgtgg
agtaaaccgaagcgtgttcgaacagcactcactcattttggatcaaaggggaaagtagtg
cccgaaccgtacggtgtgacacttattattgcaccgtggaactatccgtttcaattagca
attgcaccgcttgtaggagctttggcagctggaaatacaatcgttttaaagccatcagag
ctaacgccaaacgtttctaaagtgattacgagaatgttagcagaattattccaagaagag
cttgtagcggtagtagaaggtggcgttgaagagagtacggctttgctgaaggaaccattt
gattatatcttctttacaggtagtgtgggtgttgggaaggttgtcatggaagcagctgcg
aaacagctgacgccgcttacgttagaacttggcggaaagagcccatgtattgtacataaa
gatgcaaaagtagatgtaacagcgagacgaattgtgtggggcaagtttttaaatgcaggg
caaacgtgtgtagcacctgattatctgtatgtgcatgcttctgtgaaagagcagttaatc
gaggcattgcgacacgaaattgcggagcagtatgggaacgagcctttgcaaaatgaaaat
tacgtacgcattgtaagtgagcggcattttgaacgattatgccggtttttacaagatggt
caagtcgcaatcggcggtaactataagcgagatacattacatattgaaccgacagtagtg
aaggatattacatggcaagatgctgtcatggaagatgaaatttttggtccgattttacca
attatagagtacgaaaacatagaagaggtaattgacacaattcagcaacacccgaaaccg
ttagcgttatatgtattctctgaagataaagaaatgcaaaagaaagtaacgagtaatatt
tcgtatggcggaggctgtgtgaatgatgttgtttatcatcttgcaaccccatatttacct
tttggaggcgtcggaagtagtggattagggagttaccatggggaagaaagttttcggact
ttttcacattataaaagcattttagcccaatctacggcattcgatatgaaaattcgttac
tcttctacaaaaagtgctttaaaattcatacgaaagttgttaaaatga

DBGET integrated database retrieval system