KEGG   Bacillus thuringiensis HD1011: BF38_270
Entry
BF38_270          CDS       T03675                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00020  Citrate cycle (TCA cycle)
btw00190  Oxidative phosphorylation
btw00650  Butanoate metabolism
btw01100  Metabolic pathways
btw01110  Biosynthesis of secondary metabolites
btw01120  Microbial metabolism in diverse environments
btw01200  Carbon metabolism
Module
btw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF38_270 (sdhA)
   00650 Butanoate metabolism
    BF38_270 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BF38_270 (sdhA)
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BF38_270 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BF38_270 (sdhA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 Not3 FAD_binding_3
Other DBs
NCBI-ProteinID: AJG76081
UniProt: A0A0B5NQ57
LinkDB
Position
complement(259384..261177)
AA seq 597 aa
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIKSFGADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDISLIKPRKRDYSSKHDVAAKGEEKGDKQHV
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcggaagcaggagtaaatgttgaactgttctctttagtaccagtaaaacgttcgcat
tctgtatgtgcccaaggtggaattaacggtgccgtgaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaacgcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcatgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttgttgatgacgaaggtgtgtgccgaggaatcgttgcacaagacttacaaaca
atggagattaaaagtttcggagctgatgccgtgattatggcaacagggggccctggtatc
atcttcggaaaatcaactaactctattattaatacaggtacagcagcttctgctgtatat
caacaaggcgcatattatgcaaacggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtcttatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtacttcttagaagaaaaatatccggcttacggaaat
cttgtacctcgtgatatcgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaatatggtttacttagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaaatttacaggtgatgatcctcgt
aaactaccaatgaaaatcttcccagctgttcactattcaatgggcggactatgggttgat
tataaacagatgacaaatattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgtcttggtgcgaactcactattatcagcaatttacggtggtatggta
gcaggaccgaatgcaattgaatatatgaaaggtctttctaaatcatcagatgctgtttca
tctactgtgtatgaacaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
ctcgatggtaacgaaaatgcgtatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaaattattagaaacagatgcaaaaattgaagag
ttaatggctcgttataaacgtattaacattaacgatacagcaagatggagtaaccaaggt
gcttcatttacacgccaacttgcaaatatgtttgagctagcacgtgttattacaattggt
gcatataaccgtaatgagagccgtggggcgcattacaaacctgaattcccaaatcgtgat
gatgcaaacttcttaaaaactacgatggcaaaatttgaaggagaaggaaatgcaccagca
ttccattatgaagatgtggatatttcattaattaaaccacgtaaacgtgattattcttca
aaacacgatgtagctgctaagggtgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system