KEGG   Bacillus thuringiensis HD1011: BF38_3290Help
Entry
BF38_3290         CDS       T03675                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00473  D-Alanine metabolism
btw01100  Metabolic pathways
btw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF38_3290 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF38_3290 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btw01011]
    BF38_3290 (alr)
Enzymes [BR:btw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF38_3290 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:btw01011]
 Precursor biosynthesis
  Racemase
   BF38_3290 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker DUF4170
Motif
Other DBs
NCBI-ProteinID: AJG74542
UniProt: A0A0B5XFQ1
LinkDB All DBs
Position
3154003..3155229
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGINQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDV
MMTVYRSEDLQGINEIANRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMELSNTFQNMV
RVGIGIYGMYPSKEVNHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacataatgtaaaa
gaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcaggaataaatcag
cttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaattaacgtgccg
attttaattttaggctatacatcagtagcggctgcggaagaagcaattcaatatgacgtt
atgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgcaaaccgtctt
caaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcattggtttacag
gaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgtagaggtagtg
ggaatgtttacacattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcatattccatat
attcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaaaatatggtt
cgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcattcagttgtt
tcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcatgcgaagaaa
aatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatggattgccacc
gtaccgattggttatgctgatggttataatcgtcagttgtctaataaagggcatgcatta
ataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctcatgttagac
gtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggtaaacaaggc
gaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaactatgaagtt
acatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaaacaactgct
gttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system