KEGG   Bacillus thuringiensis HD1011: BF38_3345
Entry
BF38_3345         CDS       T03675                                 

Definition
(GenBank) UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain protein
  KO
K21739  probable pyridine nucleotide-disulfide oxidoreductase
Organism
btw  Bacillus thuringiensis HD1011
Brite
KEGG Orthology (KO) [BR:btw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BF38_3345
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 DAO K_oxygenase 3HCDH_N 2-Hacid_dh_C TrkA_N Thi4 NAD_binding_8 GIDA FAD_binding_2 UDPG_MGDP_dh_N NAD_binding_2 Lycopene_cycl
Other DBs
NCBI-ProteinID: AJG76793
UniProt: A0A0B5NXB4
LinkDB
Position
3201654..3203030
AA seq 458 aa
MTKFDAIIIGFGKGGKTLAADLAKRNWKVAVVERSNKMYGGTCINIGCIPTKSLAQQAKQ
EQIKEVQDWKVKFDHYDQAIQQKDELITFLRQKNYDNLAQHKNIQVFNGTASFVSDHEVQ
ITSDKEKTVLSASRIFINTGAEMIIPKITGIQESQHVYTSTSIMDLKKLPKRLAIIGGGY
IGLEFASIYRQFGSEVTVLEGFTKFIAREDRDVADEVYDVLSKKGIDIKLNAKVMGLKDT
QEGTMISYEVAGEAGQIEVDAVLLATGRKPNVEGLNLEAAGVALNERGAIQVDAQLRTTV
PHIWALGDVKGGLQFTYISLDDYRIVKDSLFGNGTRHIEDRITVPYSVFIEPPLSRVGLS
EEEAIQQGYNIKMAKLPAAAIPRARLIQETDGFMKAIVDADTNKILGATLFCAESSEVIN
IVSMAIQMGQPYTFLRDHIFTHPTMSEALNDLFSQIKE
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgacaaaatttgatgcaatcattattggatttgggaagggcggaaaaacactggccgcg
gatttggctaaacgtaattggaaagtagctgttgttgaacgctccaataaaatgtacgga
ggaacctgtatcaatatcgggtgcatacctacgaaatcattagcccaacaagcgaagcaa
gagcaaattaaagaggttcaagattggaaggttaagttcgatcattatgatcaggcaatc
cagcaaaaagatgaacttatcacatttctacgtcaaaaaaactatgataatctagctcag
cataaaaatattcaagtatttaatggaacagcatcgtttgtatccgatcatgaagtgcag
attacctcagataaagagaaaaccgtcttatctgcttctcggatcttcattaatacaggg
gctgagatgattatcccaaaaattacaggtattcaagagagtcagcatgtctacacgagc
acatccattatggatctgaaaaagcttccaaagagactggcgattattggtggtggctat
atcggattagaatttgcatccatctatcgtcaattcggctcggaagtaaccgttttagag
ggcttcactaaatttattgcacgtgaagatcgagatgtagcggatgaagtttatgatgtc
ctttccaagaaaggcattgatattaagctgaatgctaaagttatgggactcaaagataca
caagaaggaacgatgatttcctatgaggtagcaggtgaagcagggcaaatagaagtagat
gcagtcttgctggcaacaggtagaaaaccgaatgtggaaggacttaacctggaagcagca
ggtgttgcgctgaatgaacgaggtgctatacaagttgatgcacaactaaggactactgtc
ccacatatatgggcacttggtgatgtaaagggtggattacaattcacttatatatcactc
gatgattatcgaatcgtgaaggatagtctctttgggaatggcacccgtcatatcgaagat
cgaatcactgtcccttatagtgtatttattgagccgccactatcccgtgttggacttagt
gaggaagaagcaattcagcagggatacaacattaaaatggcgaagcttcctgctgcagcg
attccacgtgctcgcttaatccaggaaacagacggattcatgaaggcgattgtagatgcc
gatacgaataagattcttggagctaccttgttctgtgccgaatctagtgaagtcattaat
atcgtaagtatggcaatccaaatgggacaaccctatactttcctaagagatcatatcttt
acacatccaactatgagtgaggctttgaatgatttgttctcccaaatcaaagagtag

DBGET integrated database retrieval system