KEGG   Bacillus thuringiensis HD1011: BF38_3634
Entry
BF38_3634         CDS       T03675                                 

Definition
(GenBank) FAD binding domain protein
Organism
btw  Bacillus thuringiensis HD1011
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 HI0933_like FAD_oxidored Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox GIDA Pyr_redox_3 Lycopene_cycl MCRA Trp_halogenase GDI
Other DBs
NCBI-ProteinID: AJG75148
UniProt: A0A0B5NSR7
LinkDB
Position
3491218..3492528
AA seq 436 aa
MKKFDVAIVGGGLAGLTASIYLAKAGRKVIVLEKSSRFGGRGMTINKNGICMNLGAHALY
RGGAAFLTFNELGMNLPGGIPSTKAHGIWKGDIFTIPTDFRSILSTPLLSWSAKVQFLRL
IIRLGHLNIGEVPKMSLTTWTENEIKDPMVRNIFYALCRTTTYTFAPTIQLASSVLKQIQ
LSIKEGVFYVDGGWETIITKLRDIANHVGVQFLAKKHVLEIEHYEDKQRIYCFDDEVFEV
GTVIVTTPPKEACNIIKGAEGTSLHRWSEQSVPVTVAALDIGLRRLPNPTHQFALGLDQP
IFFTNQSRAAKLSDDGSIAVSLIKYQNPALEMKHTHEDKGQLESTMDLLHPNWKREVVAQ
QYLPTIKVVYDFPHINRVETPGPNIPEMPGVYVAGDWAGHDEILADAAVASGKRAALHIL
KQLESEAVHHGNGAII
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaagaaatttgatgtagcaattgttggtggtggccttgctggattaacagcatctata
tatttagcgaaagctggaaggaaagtgattgtgttagaaaagtccagtcgatttggtggt
cgagggatgactataaataaaaatgggatctgtatgaaccttggtgcgcacgccttatat
agaggaggagcagcatttttaacttttaatgagctcggtatgaatctaccgggtggaatt
ccatctacaaaagcacatggaatatggaaaggggatatattcactatcccaacagatttt
cgctcaattttatcaacaccactactttcgtggtctgcaaaagtacaattcttacgtcta
ataattcgtttagggcatttaaatataggagaagttccaaaaatgagtctaactacatgg
acagaaaatgaaataaaagatccaatggttcgaaatatattttatgcattatgccgaaca
acaacatatacgtttgctcctacaatacaattggcatcatctgtactaaagcaaatacag
ctttcaataaaagaaggggtattttatgtagatggtggctgggagacgataataacaaaa
ttaagagacatagcgaatcatgtcggggtgcaatttttggctaaaaagcatgttttggaa
atagagcattacgaagataaacaaagaatatattgttttgacgatgaggtatttgaagta
ggtacagtcattgtgacgactccaccgaaagaagcttgtaacataataaaaggtgcggaa
ggaacaagcttgcatagatggagtgaacaatcggtaccggttactgttgctgcattagat
attggtttgagacgattacctaatccgacacatcaatttgcattaggattagatcaacct
atatttttcacgaatcaatcaagagcagctaaattaagtgatgatggatcaattgctgtg
agtttaattaagtaccagaatcctgcactagagatgaaacatactcatgaagataaagga
cagttagaaagtacgatggatttgttacatccaaattggaaaagagaagttgttgcacag
caatatttaccgacaataaaggtagtatatgattttcctcatattaaccgagttgaaacc
ccaggtcctaatatccctgaaatgccaggtgtttacgttgcaggtgattgggctgggcat
gatgaaatattagctgatgctgcagtagcaagcgggaaacgtgcagcgttacacatttta
aagcaattagaaagtgaggcagttcatcatggaaacggagcaattatatga

DBGET integrated database retrieval system