KEGG   Bacillus thuringiensis HD1011: BF38_3792Help
Entry
BF38_3792         CDS       T03675                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00473  D-Alanine metabolism
btw00550  Peptidoglycan biosynthesis
btw01100  Metabolic pathways
btw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF38_3792
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BF38_3792
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BF38_3792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btw01011]
    BF38_3792
Enzymes [BR:btw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BF38_3792
Peptidoglycan biosynthesis and degradation proteins [BR:btw01011]
 Precursor biosynthesis
  Amino acid ligase
   BF38_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AJG76403
UniProt: A0A0B5NW65
LinkDB All DBs
Position
3651188..3652102
Genome map
AA seq 304 aa AA seqDB search
MRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLAL
HGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMED
LNFDELDKLGFPLVVKPNSGGSSVGVKIVYNKDELISMLETVFEWDSEVVIEKYIKGEEI
TCSIFDGKQLPIISIRHAAEFFDYNAKYDNASTIEEVIELPAELKERVNKASLACYKALK
CSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRK
EEGF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttattatgggaggagtatcctctgaaaaacaagtatcaattatgact
ggaaacgaaatgattgcaaatttagataaaaataaatatgaaatcgtaccaattacgtta
aatgaaaaaatggatttaatcgaaaaagcgaaagacattgattttgcgctgctcgcatta
catggaaaatacggagaagatgggacagttcaaggaacgcttgaaagtttaggtattcct
tatagcggcagcaatatgttatctagcggtatatgtatggacaaaaatatttcgaaaaag
attttacgttatgaaggaatagaaacgccagattggattgaacttacaaaaatggaggat
ctgaattttgatgaattagataagttaggatttccgttagtagtaaaaccaaactctggt
ggttcaagtgttggagtaaagattgtctacaataaagacgaattaatttcaatgctggaa
actgtgttcgaatgggattctgaagtagtaatagagaaatatataaaaggtgaagagatt
acatgttccatttttgatgggaaacagttacctatcatttcaattcggcatgcggctgag
ttctttgattacaatgcgaaatatgataacgctagtacaattgaagaagttatcgaactt
ccagctgaacttaaggaacgtgtaaacaaagcatcactggcgtgctataaagcattaaaa
tgtagtgtttatgcaagggttgatatgatggtgaaggacggtattccatatgtaatggaa
gttaatacattaccagggatgacacaagcaagtttactaccaaaaagtgcagatgcagcg
ggaattcattatagtaaactattagatatgattattgaaacttcattaagagtaagaaaa
gaagaagggttttaa

DBGET integrated database retrieval system