KEGG   Bacillus thuringiensis HD1011: BF38_4007
Entry
BF38_4007         CDS       T03675                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase family protein
  KO
K00302  sarcosine oxidase, subunit alpha [EC:1.5.3.1]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00260  Glycine, serine and threonine metabolism
btw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF38_4007
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     BF38_4007
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 GIDA HI0933_like FAD_oxidored DAO FAD_binding_2 Thi4 NAD_binding_8 FAD_binding_3 Lycopene_cycl AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AJG78664
UniProt: A0A0B5NLF5
LinkDB
Position
3855751..3856986
AA seq 411 aa
MNDVIIIGAGPAGLSASISCARFGLNVLVIDEFMKPGGRLLGQLHQEPSGEWWNGIEESK
RLQEEAKSLSVHIRCGISVYNLDKDESCWFVHTNIGTLEAPFVLLATGAAEYSIPLPGWT
LPGVMSIGAAQVMTNVHRVQVGEKGIIIGANILSFAILNELQLAGIKVEHIVLPEKSELS
QKAGEPEEVLNSLLNAAHLAPSAFLRIGSHFMKYDWIRKAGLTFYPNSGMKINDTPLHLR
KAALEIIGTDQVEGVRVANIDTKGNIITGSEQIYEADFVCIAGGLYPLAELAAVAGCPFR
YIPELGGHVPLHSETMETPLTGLFVAGNITGIESGKIAMAQGTVAGYSIVKQANKKSHSV
EQQLQQAIQHVHAVRQEAAIQFNQGVDVGRRKMNEIWRDYSLAFAHTKKSC
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaatgatgtcataattatcggagctggaccagcgggtttatcagcctctatctcttgt
gctcgttttggactaaatgtacttgttattgatgaatttatgaagcctggcgggagattg
ttaggacaattacatcaagagccttctggagaatggtggaacggaatagaagaatcgaag
cgacttcaagaagaagcaaaatcactttcagttcatattcgatgcggtatttccgtctat
aatttagataaagatgaaagttgttggttcgtacatacgaatatcggtacgttagaagca
ccgttcgttttacttgctactggcgctgctgagtactccattccccttcccggttggaca
cttccaggagtcatgtcaatcggggcagcccaagtaatgacaaatgttcatcgcgttcaa
gttggggaaaaaggaatcattattggtgctaacattttgtcattcgctattttgaatgaa
ttacaattagcaggcatcaaagttgaacatatcgtacttcctgaaaaaagtgaattaagt
caaaaggctggagaaccagaagaagttttaaactctcttttaaatgcggctcatctcgct
ccttctgcttttctacgcataggtagccattttatgaaatatgactggattcgaaaagcc
ggattaaccttctatccaaacagcggaatgaaaataaacgatacacctcttcaccttcga
aaagcagcgcttgaaattatcggaacagatcaagttgaaggtgtacgcgttgctaatatt
gatacgaaaggaaacatcatcactggatcggaacaaatatatgaggcagacttcgtttgt
attgcaggtggcttatatcctcttgctgaactagccgctgtagccggctgtcctttccgt
tacattccggaattaggtgggcacgttcctctccattctgaaacaatggaaacccctctt
actggtttatttgtagccggcaatataactggtattgaaagtgggaaaattgcaatggca
caaggtactgttgctggatattcaattgtaaaacaggcaaataaaaaatcccattcagtt
gaacaacaattgcaacaagcaatccaacatgtacatgccgtacgtcaagaagctgccatt
caatttaaccagggtgttgatgtcggtagaaggaagatgaatgaaatttggcgtgattat
tcccttgcatttgcacatactaaaaagagctgttga

DBGET integrated database retrieval system