KEGG   Bacillus thuringiensis HD1011: BF38_5331
Entry
BF38_5331         CDS       T03675                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00010  Glycolysis / Gluconeogenesis
btw00020  Citrate cycle (TCA cycle)
btw00260  Glycine, serine and threonine metabolism
btw00280  Valine, leucine and isoleucine degradation
btw00310  Lysine degradation
btw00380  Tryptophan metabolism
btw00620  Pyruvate metabolism
btw00630  Glyoxylate and dicarboxylate metabolism
btw00640  Propanoate metabolism
btw01100  Metabolic pathways
btw01110  Biosynthesis of secondary metabolites
btw01120  Microbial metabolism in diverse environments
btw01200  Carbon metabolism
Module
btw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF38_5331 (lpdA)
   00020 Citrate cycle (TCA cycle)
    BF38_5331 (lpdA)
   00620 Pyruvate metabolism
    BF38_5331 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    BF38_5331 (lpdA)
   00640 Propanoate metabolism
    BF38_5331 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF38_5331 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    BF38_5331 (lpdA)
   00310 Lysine degradation
    BF38_5331 (lpdA)
   00380 Tryptophan metabolism
    BF38_5331 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btw04147]
    BF38_5331 (lpdA)
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BF38_5331 (lpdA)
Exosome [BR:btw04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BF38_5331 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA Pyr_redox_3 FAD_oxidored DAO FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 3HCDH_N Thi4 HI0933_like Trp_halogenase 2-Hacid_dh_C NAD_binding_7
Other DBs
NCBI-ProteinID: AJG78531
UniProt: A0A0B5NWY9
LinkDB
Position
complement(5170710..5172131)
AA seq 473 aa
MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVY
ATAKKSEEFGVIASNVELNFAKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPS
IFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPGLELDGEYVMSSDHALKMETL
PSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGY
IQTNEFYQTKESHIYAIGDVIGGLQLAHVASHEGIVAVEHIAGKEVTPIDYSMVSKCVYS
SPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGESDGFVKLVVDEETNDILGVHM
IGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcaaaagaatatgatttagtcatcgttggcggcggtactggcggatatgttgctgca
attcgtgcatcacaactaggtttaaaaactgcacttgttgaaaaagaaaatcttggtggt
acttgtttacacaaaggatgtattcctagtaaagcccttttacgtagtgcggaagtatac
gcaactgctaaaaaaagcgaagagttcggggttattgcaagtaatgtagaactaaacttt
gcgaaagtacaagagcgtaaagagaagattgtaacgcaacttcataaaggtgttcagcac
ttaatgaaacaaggtaaaattgatgtgtttgaaggtattggccgtattcttggcccatct
attttctctccgatgccagggacaatttcagttgaacttgcaagtggagaagagaatgaa
atgttaattccaaaaaatgtacttattgcaacaggttctcgtccgaattcattaccaggt
ttagaattagacggagagtatgtaatgtcttccgatcatgccctaaaaatggaaacgctt
cctagctcgattattatcgttggtggcggtgtaattggtatcgagtgggcatctatgctt
gctgacttcggtgtagaagttacagtattagagtatgcgaaaacgatactaccattagaa
gatcaagacgtttcaaaagaaatgcaacgtctattcaagaaaaaaggtattaaagtggta
actggtgcaaaagtattaccagaaacattggtaaaagataatggagtaacaattcaagct
gaacataacggtgagaataaagaatttaaagcagaaaaaatgcttgtatctgtaggacga
caagccaatacgcaaaatattggtttagagaatacggatatcgttgtggaaaaaggatac
attcaaacaaatgagttttatcaaacgaaagaatctcatatttacgcaatcggtgatgta
atcggtggcttacagcttgctcacgttgcttctcatgaaggaattgttgcagtagaacat
attgctggtaaagaagttacaccaattgattattctatggtatcaaaatgcgtatatagc
agtccggaagttgcttctgtcggtttaacagaacaagaagcgaaagaaaaaggctataag
ttaaaagtaggtaagttctcattccgtgcaatcgggaaagcacttgtatacggcgaatca
gatggtttcgtaaaacttgtagttgatgaagaaacaaatgacattctcggtgttcatatg
attggaccacatgtaacagatatgatttctgaagcaggtcttgcaagagtacttgatgca
acaccttgggaagtagcacatacaattcatccgcatccatcattatctgaggcgattggt
gaagcagcattagctgtagatggaaaagcgttacacgcataa

DBGET integrated database retrieval system