KEGG   Bacillus thuringiensis HD1011: BF38_686
Entry
BF38_686          CDS       T03675                                 

Gene name
yumC
Definition
(GenBank) ferredoxin--NADP reductase 2
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
btw  Bacillus thuringiensis HD1011
Brite
KEGG Orthology (KO) [BR:btw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BF38_686 (yumC)
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     BF38_686 (yumC)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     BF38_686 (yumC)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like K_oxygenase NAD_binding_8 FAD_oxidored DAO Oxidored_nitro Thi4 FMO-like NAD_binding_7
Other DBs
NCBI-ProteinID: AJG77701
UniProt: A0A0B5WBT7
LinkDB
Position
631338..632327
AA seq 329 aa
MAENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAG
FPKVRAQELVDNLKEQMKKFDPTVCLEEAVDTLEKQADGIFKLVTNKQTHYSKSVIITAG
NGAFQPRRLELEGTAKYEKKNLHYFVDDMNKFAGKRVVVFGGGDSAVDWTMMLEPIADKV
TIVHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKIIIDVD
DVIVNYGFVSSLGPIKNWGLDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGF
GEAPTAVNNAKAYFDPNAKLQPMHSSSMF
NT seq 990 nt   +upstreamnt  +downstreamnt
gtggcagaaaatcaaaaagtttacgacataacgattattggtggtggtccaacaggacta
ttcacagcattttatggcggtatgagacaagcaagtgtaaaaattattgaaagcttacct
cagcttggaggacaattatccgcactctaccctgaaaaatacatttatgatgtagctgga
ttcccgaaagtgcgtgcacaagagttagttgataatttaaaagagcaaatgaagaaattt
gatccaaccgtttgcttagaagaagctgttgatacgcttgagaaacaagctgacggtata
tttaaacttgttacaaataagcaaactcactattctaaatcagtcattattactgctggt
aacggtgctttccaaccacgccgcttagaattagaagggacagcaaagtacgaaaagaaa
aatttacattatttcgttgatgatatgaataaatttgctggtaagcgcgtcgtagtattt
ggcggcggcgattcagctgttgattggacaatgatgttagagccaatcgctgacaaggtt
acaatcgttcatcgccgtgataaattccgtgcgcatgaacatagcgtagaaagcttaatg
aactctcgtgcagaagtaagcacaccgtacgttccagtagaactcattggtgatgacaaa
attgaacaagtcgttcttcagcatgtaaaaacggaagaaaaaattatcatcgatgttgat
gacgtaatcgtaaactacggcttcgtttcttcccttggcccaattaaaaactggggctta
gatatacaaaaaaacagcattctcgtgaactcgaaaatggaaaccaatattcctggcatt
tacgctgctggtgacatttgtacatatgaaggaaaagtaaaacttatcgcttgcggcttc
ggtgaagcaccaacagcagtaaacaatgcgaaagcttacttcgatccaaacgcaaaactt
caaccgatgcacagctctagtatgttttaa

DBGET integrated database retrieval system