KEGG   Bacillus thuringiensis HD1011: BF38_886
Entry
BF38_886          CDS       T03675                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BF38_886 (trxB)
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BF38_886 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 DAO GIDA NAD_binding_8 FAD_oxidored Thi4 K_oxygenase Lycopene_cycl HI0933_like FAD_binding_3 NAD_binding_7 Mqo zf-TFIIB
Other DBs
NCBI-ProteinID: AJG79308
UniProt: A0A0B5XQY3
LinkDB
Position
complement(828915..829871)
AA seq 318 aa
MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESIL
GPDLSNKMFEHAKKFGAEYAYGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIG
VPGETELGGRGVSYCAVCDGAFFKGKELVVIGGGDSAVEEGVFLTRFASKVTIVHRRDTL
RAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
MLPLSKPFVELGITNENGYLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQS
AQHYVEELLEELKTVSEK
NT seq 957 nt   +upstreamnt  +downstreamnt
gtgtcagaagaaaaaatttatgatgtcattattattggtgcaggaccagctggtatgaca
gctgcagtatatacatctcgtgcgaatttaagcacattaatgcttgagcgtggtattcca
ggcggacaaatggcaaatacagaagatgtagaaaactacccaggttatgagtctatttta
ggaccagacttatcaaataaaatgttcgagcatgcgaagaaatttggtgctgaatatgca
tacggtgatgtgaaagaagtcatcgatggtaaagaatacaaaacaattattgctggtaaa
aaagaatataaagcacgtgcaattatcgttgcaagtggtgcagagtataaaaaaattggt
gtaccaggtgaaacagaacttggcggccgcggtgtatcatattgtgcggtatgtgatggc
gcattctttaaaggaaaagaacttgtagttattggcggcggagattctgctgttgaagag
ggtgtgttcttaacacgcttcgcatcaaaagtaacgatcgttcaccgtcgtgacacgctt
cgtgcacagaaaattttacaagaccgtgctttccaaaacgaaaaagtagacttcatttgg
aaccacacgataaaagaaattaacgaagcaaatggtaaagtaggaagtgtaacacttgta
gacgtaaacagtggagaagagaaagaagtcaaaactgacggcgtattcgtatacatcggt
atgttaccactttcaaaaccatttgttgaactaggtattacaaatgaaaatggttacctt
gaaacaaacgagcgtatggaaacgaaagttcctggtattttcgcagcaggtgatgttcgt
gaaaaaatgctacgtcaaattgtaactgcaacaggtgatggtagtattgcagcacaaagt
gcacagcattacgtagaagaattattagaagaactaaaaaccgtatcagaaaaataa

DBGET integrated database retrieval system