KEGG   Bartonella tribocorum BM1374166: BM1374166_02072
Entry
BM1374166_02072   CDS       T03233                                 

Gene name
tolB
Definition
(GenBank) translocation protein TolB
  KO
K03641  TolB protein
Organism
btx  Bartonella tribocorum BM1374166
Brite
KEGG Orthology (KO) [BR:btx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btx02000]
    BM1374166_02072 (tolB)
Transporters [BR:btx02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BM1374166_02072 (tolB)
SSDB
Motif
Pfam: TolB_N PD40 DUF5050 DPPIV_N Pectate_lyase22 Phytase-like
Other DBs
NCBI-ProteinID: CDO49715
LinkDB
Position
complement(2314165..2315490)
AA seq 441 aa
MMTITRHRVFTWFIVTCSLWLSSMSSVYAQLKGTISSADFNPIPIAITDFISNDSIGSKI
TAVVTADLERSGLFVPLDKENFFEKISNPNKQPHFASWQKIKAQGLVMGQVMREIDGRLR
VDFRLWDVFGQRQLKGRRFYTATERWRRVAHMIADEIYSEMTGESGYFDTRIVFIDETGP
QNARIKRLAMMDQDGANLIYMSDGSELVLTPRFSPKRQEMTYMAYEDNQVPHVYLQQIEM
GQRELIGTFHNMTIAPRFSSDGQKVIMSLLQNDGSANLYTMDLRTRTMTRLTTTSAIDTS
ASYSPDGQQIVFSSDRSGKPQIYKMNADGSDIQRISSNEGSYSTPIWSPRGDYIAFTKQL
SGQFSIGVMRPDGQGERILTTGFHNEGPTWAPNGRVLMFFRKNPGMGPKIYTIDITGRNE
RQLPTPNDASDPAWSPLLNIQ
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgatgactataacgagacatagagtttttacgtggtttatagtcacttgtagtttgtgg
ctttcaagtatgtcatcagtttatgcgcagttgaaaggaacgatttcgagcgctgacttt
aaccctattcccattgcaattacagactttatttcgaatgattcgattggatctaaaata
acggctgtggtgacagctgatcttgaacggtcggggctttttgtaccacttgataaggaa
aatttttttgaaaaaatttctaatccgaataaacaaccgcattttgcttcatggcagaaa
ataaaggcgcaaggtttggtgatggggcaagtcatgagagaaatcgacggacgtttgagg
gttgattttcgtttatgggatgtttttggacagcggcaattgaaaggacggcgtttttat
actgcgacagaacggtggcggcgtgtggctcatatgattgcagatgagatctacagtgag
atgacgggggaaagtggttattttgatacaagaattgtttttatcgatgaaacaggtccc
caaaacgcacgtattaaacgtttagcaatgatggatcaagatggcgcaaatttgatttat
atgtctgatgggagtgaattggtgcttacaccacgtttctcacccaaaagacaagaaatg
acctatatggcttatgaggacaatcaagtgcctcatgtttatctccaacaaattgaaatg
ggacaaagagagttgattggaacgtttcataacatgacaattgctccgcgtttttcttct
gatggacaaaaggtcattatgagtttgctgcaaaatgatgggagcgccaatctttacacc
atggatttacgcacccgtaccatgacacgtcttacaacaacttctgctattgatacctct
gcttcttattcaccagatggacaacaaattgtcttttcttcagatcgtagcggaaagccg
caaatttataaaatgaatgcggatggcagtgatattcagcgtatttcttcaaatgagggg
agttattcgacacctatttggtcgccacggggggattatatcgcctttacaaaacaatta
agcggacaattttctatcggtgttatgcgccctgatggacaaggagagcgaattttaacc
acagggtttcataatgaaggtcccacttgggcgcctaatggacgtgtgttgatgttcttt
cgcaaaaaccccggtatgggacccaaaatctataccattgacattacgggacgcaatgaa
cgacaactccccacacccaatgatgcttccgatccggcgtggtcgccattgcttaatata
caataa

DBGET integrated database retrieval system