KEGG   Bacillus toyonensis: Btoyo_1099Help
Entry
Btoyo_1099        CDS       T02901                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bty  Bacillus toyonensis
Brite
KEGG Orthology (KO) [BR:bty00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bty01001]
    Btoyo_1099
Enzymes [BR:bty01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Btoyo_1099
Protein kinases [BR:bty01001]
 Serine/threonine kinases: Other
  Bacterial family
   Btoyo_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Haspin_kinase RIO1 Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AHA07106
LinkDB All DBs
Position
complement(1095868..1097841)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIEQGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGVVKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPRRWNENIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFENVTDETIVLSGSKVDEPKRKEHTELDKKKKRSNKWIKVLITTFLLLAIGITLALTVI
PGFFIPKDVKVPDVAGMKYTTAVNKLVEKGFEVTEPNIVYTDDVEAGDVIKTDPVAGRVV
KESSKITIYQSGGKKKSKMKDFTGQNFESVKPELEERYKQVTENYIENDKPKGEIVEQIP
TPDQMVVEAEQELKVWISKGPYQNRPGDFSRWTENSATGDLNERKLTPDIKREYSDTVDK
GLVISQSPKPGTPLKEGDKVTLIISNGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEI
YKEDMQQKMDRPIETRTISESATISLEFVIQEGSKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctaaaaatgattggcggtgga
gggatggccaatgtatatttagctcatgatgacatactcggccgagatgtagcggtgaaa
atattaagactcgactattccaataacgaagagtttattaaacgtttccatcgagaagcg
caatctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgttggagaagaa
gatggtatatattatcttgtaatggagtatgtacctggacaaacattaaagcaatacata
attgagcaagggatgttacctataggggaagctcttgatattatggagcaattaacatcc
gccatggcacacgctcatcattttgaaattgtgcatcgtgatataaaaccgcacaatatt
ttaattcgagctgatggagtagtaaaagtaacagattttggaattgcgacagctacaagt
gcaacaactattacacatacaaattcagtacttggttcggtgcattatttatcaccagaa
caagcgcgcggcgggatagcaaataaacaatcagatatttattcgcttggtattgttatg
ttcgaattgttaacaggaagacaaccgttttctggtgaatctgctgttgcaatagcttta
aaacatttacaaagtgaaataccgtctccaagaagatggaatgaaaatattccgcaaagt
gttgagaatattatattaaaggcaactgctaaagatccgttccatcgataccaatctgct
aatgcgatgaaacgagatattgaaacggctttatatccagaacgaattaatgaacagcca
ttttacataccagaagatatggaagcgacgaaagcgattccaattatccaacaagaacaa
ttatttgaaaatgtaactgatgaaacgattgttttaagtggaagtaaagtggatgaacca
aaaagaaaagaacatactgaattagataagaagaaaaaacgaagtaataaatggattaag
gttttaattacgacatttttacttttagcaattggaataacattagctcttactgttatt
ccgggattctttattccgaaagatgtaaaagttcctgatgtggctggtatgaaatatacg
acagctgtaaataagttggtagaaaaaggttttgaagtgacagaacctaatattgtatat
acagatgatgtggaagctggagatgtaataaaaactgatcctgtagcaggaagagtagtg
aaggaaagttctaaaattactatctatcaatcaggtggaaaaaagaaaagtaagatgaag
gattttacaggtcaaaactttgagagtgtaaaacccgagttagaagaaagatataaacag
gttactgaaaattatattgaaaatgataaaccaaaaggtgaaattgtagaacaaataccg
acacctgatcaaatggttgtagaggcggagcaagaactgaaagtttggataagtaaaggt
ccttatcaaaatagaccaggtgatttttcaagatggactgaaaatagtgcaactggtgat
ttgaatgagagaaaattaactccagatataaaacgagagtattcagatacggttgataaa
ggtcttgtaatttcgcaatcgccaaaaccaggaactccgttaaaagaaggagataaagtg
acacttatcatctcgaatggccctaagccgaaagtaacaaaaacagtgaaggtggataac
atttctatcccatatgagtcttctataataggtgagaaaaaaccgcaaacaatagaaatt
tataaagaagatatgcaacaaaagatggatagaccaattgaaactagaacgatttcagag
tcggcaacaatttctttagaatttgtaattcaagaaggctcaaagggtcactataaaatc
gtacgggatggagtaacgattatcgataaggaagtaccatatccaactcaataa

DBGET integrated database retrieval system