KEGG   Bacillus toyonensis: Btoyo_1653Help
Entry
Btoyo_1653        CDS       T02901                                 

Definition
(GenBank) Stage V sporulation protein B
  KO
K06409  stage V sporulation protein B
Organism
bty  Bacillus toyonensis
Brite
KEGG Orthology (KO) [BR:bty00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bty02000]
    Btoyo_1653
Transporters [BR:bty02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Btoyo_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C MatE MurJ
Motif
Other DBs
NCBI-ProteinID: AHA07658
LinkDB All DBs
Position
1617043..1618302
Genome map
AA seq 419 aa AA seqDB search
MGIMLLTPILAKTLLTDERTYYPLMAILPVVPVIAVSSVLRGYFQGKQNMKPSAYAQVIE
QVVRITIIAVCIRIFLPYGVEYAAAGAMLSAVLGEVASLLFLLTLFQREKHLSIRSRFFT
TVKESKGTFYSLMDIALPTTGSRLIGSVSYFFEPIVVMQSLAIAGVAASVATQQYGILNG
YAFPLLSLPAFITYALSTALVPSISEAMAKRQHKLVEHRLQQALRISLITGGWSVVILYV
FASPVLTLMYGSDSATAFIQLLAPCFLFHYFQSPLTSVLQALNLARAAMMNTFIGAIVKL
IVIFVLASKPEFQMMGVALAIAANIVTVTFLHYATVLKKITFTIYAKDYIFGGLAIGIAG
AFGFYLHKYIIFSHSLGIQTLWEITLTTMVYVVLLFIFKLIRKEELSRLPIIRKLSFLK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggcattatgctcctcacacctattttagcgaaaacattattaaccgatgaaagaacg
tactatccattaatggccattttacctgtcgttcctgttattgctgtttcttctgtttta
cgcggttatttccaagggaaacaaaatatgaaacctagcgcttatgctcaagtgatcgaa
caagttgtccgcattacaattatcgctgtatgtattcgaatatttttaccttatggcgta
gaatatgctgcagccggcgctatgttatcagccgttctcggcgaagttgcatccttatta
ttcttactcactttattccaacgtgaaaaacacttatctatacgctctagatttttcact
accgtaaaggagagcaaaggtacattttattctcttatggatatcgcccttccaactaca
ggaagtcgtttaatcggttctgtttcttatttttttgaacctatcgtcgttatgcaaagt
ttagcgattgccggagttgccgcttctgtcgcaacccagcaatacggtatattaaacggt
tatgcattcccgctcctatcactacccgccttcattacatacgctctttctacagcgctc
gttccttcaattagtgaagcaatggcaaaaaggcaacataaattagtggagcaccgttta
caacaagcacttcgaatttcattaattactggtgggtggtctgtcgttatattatacgta
ttcgcttcccctgttttaactcttatgtacggatcagacagcgcaacagcattcattcag
ctacttgcaccttgctttttatttcattattttcaaagtccacttacatctgtattgcaa
gctttaaatttagcacgcgctgctatgatgaacacatttattggcgccatcgtgaaatta
atcgttatttttgtactagcttcaaagccagaatttcaaatgatgggggttgctctcgct
attgcagcaaatatagtaacagtaacattccttcactacgctaccgttttaaaaaagatt
acatttaccatttacgcaaaagactatattttcggcggacttgccatcggtatcgcaggt
gcctttggtttttaccttcataagtatattattttctctcattctcttggtatacaaaca
ttatgggaaatcactttaacaacaatggtttatgtcgttctcctcttcatctttaaacta
attcgaaaagaggagttaagtcgcctccctatcattcgtaaactttcatttttgaaataa

DBGET integrated database retrieval system