KEGG   Bacillus toyonensis: Btoyo_1656Help
Entry
Btoyo_1656        CDS       T02901                                 

Definition
(GenBank) hypothetical protein
Organism
bty  Bacillus toyonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792 DUF4199 DUF4203 SLATT_5 Peptidase_U4
Motif
Other DBs
NCBI-ProteinID: AHA07660
LinkDB All DBs
Position
1619118..1619501
Genome map
AA seq 127 aa AA seqDB search
MDGTKKLSTAIGFGIITLLILASITSMVMALLLKFTNMNESTLTVTILILALLSMLMSGF
IAGKKAQGKGWLVGFTTGLTFAILVFLVNYLGFSQTLSNSQLLYQLALMGASTLGGIFGV
NMSKQNN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggatggaacgaaaaaattatcaactgcaattggtttcggtattattaccctactaatt
ctcgcatctattactagcatggttatggctctattattaaagtttacgaacatgaatgaa
agtacattaaccgtcactattttgatactagctcttttatctatgcttatgtctgggttt
attgctggtaaaaaagcacaagggaaaggttggctagttggttttacaacaggactcaca
ttcgccatactcgtttttctagttaactatttaggcttctctcaaactttatcgaactca
cagttactttaccaattggcattaatgggcgcgagtacactcggtggtattttcggtgta
aatatgtcaaagcaaaataattaa

DBGET integrated database retrieval system