KEGG   Bacillus toyonensis: Btoyo_1657Help
Entry
Btoyo_1657        CDS       T02901                                 

Definition
(GenBank) Preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
bty  Bacillus toyonensis
Pathway
bty02024  Quorum sensing
bty03060  Protein export
bty03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bty00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Btoyo_1657
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Btoyo_1657
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Btoyo_1657
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bty02044]
    Btoyo_1657
Secretion system [BR:bty02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Btoyo_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 Chordopox_G3 DUF2615
Motif
Other DBs
NCBI-ProteinID: AHA07661
LinkDB All DBs
Position
complement(1619539..1619799)
Genome map
AA seq 86 aa AA seqDB search
MNAGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQNELAKGDAIITIGGLHGTIESVD
ETKIVVKSGGAHLTFDRNAIREVVKN
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggtatgatgaatatcgttatgatcgttgcgatgtttgcgattttctatttc
ttattaattcgcccgcaacaaaagcgtcaaaaagcagttgctcaaatgcaaaacgaatta
gcaaaaggtgatgctatcataacaattggtggcttacacggtacaatcgaatcagtagat
gaaacgaaaatcgttgttaaatctggtggtgcacacttaactttcgatcgcaatgcgatt
cgtgaagttgtgaaaaactaa

DBGET integrated database retrieval system