KEGG   Bacillus toyonensis: Btoyo_1753Help
Entry
Btoyo_1753        CDS       T02901                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bty  Bacillus toyonensis
Pathway
bty00020  Citrate cycle (TCA cycle)
bty00190  Oxidative phosphorylation
bty00650  Butanoate metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
bty01120  Microbial metabolism in diverse environments
bty01130  Biosynthesis of antibiotics
bty01200  Carbon metabolism
Module
bty_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bty_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Btoyo_1753
   00650 Butanoate metabolism
    Btoyo_1753
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Btoyo_1753
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Btoyo_1753
    1.3.5.4  fumarate reductase (quinol)
     Btoyo_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AHA07755
LinkDB All DBs
Position
complement(1717043..1717804)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQEFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagatggaccagatgcacaagag
tttgaccaagagtttgaaattccatatcgtccaaatatgaatattatttcggcacttatg
gaaattcgccgtaatcctgttgattcaaaagggaaccaaacaactccgattgcatgggat
atgaactgtttagaggaagtatgtggcgcttgctcgatggttattaacggaaaaccacgt
caatcatgtacagcgcttattgatcaattagaacagccaattcgcttaaaaccgatgaag
acattcccggttgtacgtgatttacaagttgaccgtagtcgtatgtttaacgcattaaaa
cgcgttaaggcttggattccaatcgatggtacgtatgacctaggtccaggaccaagaatg
ccggagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaacagtaaatctgactttattggaccagcaccgttatca
caagctcgtttattcaactcgcatccaacaggtgaaatgcacaaagcagatcgcttacgt
gcaattatgggagatggagggcttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccgaaaggtattccattaacaacttcaatcgcagcattaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgataataactattaa

DBGET integrated database retrieval system