KEGG   Bacillus toyonensis: Btoyo_1754Help
Entry
Btoyo_1754        CDS       T02901                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bty  Bacillus toyonensis
Pathway
bty00020  Citrate cycle (TCA cycle)
bty00190  Oxidative phosphorylation
bty00650  Butanoate metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
bty01120  Microbial metabolism in diverse environments
bty01130  Biosynthesis of antibiotics
bty01200  Carbon metabolism
Module
bty_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bty_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Btoyo_1754
   00650 Butanoate metabolism
    Btoyo_1754
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Btoyo_1754
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Btoyo_1754
    1.3.5.4  fumarate reductase (quinol)
     Btoyo_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 Not3
Motif
Other DBs
NCBI-ProteinID: AHA07756
LinkDB All DBs
Position
complement(1717797..1719590)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIKSFQADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTSIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
SSVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEEVDVSLIKPRKRDYSSKHDVAAKGEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcagaagcaggagtaaatgttgaactgttttcattagtaccagtaaaacgttcacat
tctgtatgtgctcagggcggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggatttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtattattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaacacaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttgttgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattaaaagtttccaagctgatgccgtgattatggcaacagggggccctggtatc
atctttggaaaatcaactaactctattatcaatacaggtacagcagcgtctgctgtatat
caacaaggtgcatattatgcgaacggtgagtttattcaaatccatccaacggcaattcct
ggagacgataagttacgtcttatgagtgaatctgcacgtggtgaaggtgggcgtgtttgg
acatataaagatggtaagccatggtacttcttagaagagaaatatcctgcttacggaaac
cttgtacctcgtgatattgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacctagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaagtttacaggagatgatcctcgt
aaactaccaatgaaaatcttcccagcggttcactattcaatgggcgggctatgggttgat
tataagcaaatgacaagcattccaggtttatttgcagcaggtgagtgcgattattctatg
cacggtggtaaccgccttggtgcgaactcactattatcagcaatttacggtggtatggta
gcaggaccgaacgcaattgagtatatgaaaggtctttctaaatcatctgatgctgtttct
tctagtgtatatgagcaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
cttgatggtaacgaaaatgcatatgttcttcacaaagagctgggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaagttattagaaacagatgcaaaaattgaagag
ttaatggcgcgttacaaacgcattaacattaacgatacagcaagatggagtaaccagggt
gcttcatttacacgtcaacttgcaaatatgtttgagctagctcgtgttattacaattggg
gcatataaccgtaatgaaagccgcggagcgcattacaaaccggaattcccaaatcgtgat
gatgcaaacttcttaaaaactacaatggcaaaatttgagggagaaggaaatgcaccagca
ttccattacgaagaagtggatgtttcattaattaaaccacgtaaacgtgactattcttca
aaacatgatgtagctgctaagggtgaagagaagggggataagcaacatgtctga

DBGET integrated database retrieval system