KEGG   Bacillus toyonensis: Btoyo_1830Help
Entry
Btoyo_1830        CDS       T02901                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bty  Bacillus toyonensis
Pathway
bty00020  Citrate cycle (TCA cycle)
bty00480  Glutathione metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
bty01120  Microbial metabolism in diverse environments
bty01130  Biosynthesis of antibiotics
bty01200  Carbon metabolism
bty01210  2-Oxocarboxylic acid metabolism
bty01230  Biosynthesis of amino acids
Module
bty_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bty_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Btoyo_1830
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Btoyo_1830
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Btoyo_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHA07832
LinkDB All DBs
Position
complement(1796473..1797765)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWEAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTDSVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccatttatcgaaggagatggaattggtcctgatatttgggaagctgcatctcgc
gtactagaagcagcagtagaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagagacttta
aatttaatccgtgaatatttaatcgcaattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcgcttcgtcaagaattagatttatacgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatctatgctggaattgaatatgcacaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaaaccaatttcagaagaagggacaaagcgtctt
gttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttctgttacattagttcat
aaaggaaacattatgaaatttacagaaggtgctttcaaaaactggggttatgaagttgcg
gaacaagaatttggcgataaagtatttacttgggctgaatatgatcgcatcgttgaaaaa
gatggcaaagatgcagcgaataaagcgatggcagacgcagaagtggctggaaaaatcatc
gtaaaagattctattgcagatatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaatggtgactatatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtgactggacatgctatc
tttgaagctacacatggtacagctccaaaatatgcaggtttagacaaagtaaacccatct
tctgttcttctttctggtgtattattactagaacatttaggatggaatgaagctgcgaaa
ttagtaactgattcagttgagaaaacaattgcatcaaaagtagtaacatacgacttcgct
cgtctaatggaaggcgcaacagaagtgaaatgttctgaatttgctaatgagcttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system