KEGG   Bacillus toyonensis: Btoyo_2923Help
Entry
Btoyo_2923        CDS       T02901                                 

Definition
(GenBank) Oligopeptide transport ATP-binding protein OppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bty  Bacillus toyonensis
Pathway
bty02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bty00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Btoyo_2923
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bty02000]
    Btoyo_2923
Transporters [BR:bty02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Btoyo_2923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 TniB IstB_IS21 Mg_chelatase AAA_16 ATP-synt_ab AAA_25 NACHT AAA_7 Sigma54_activat DEAD RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHA08866
LinkDB All DBs
Position
2834633..2835613
Genome map
AA seq 326 aa AA seqDB search
MSKAVVELKDLQTHFQTEEGTVKAVNHVSFAVREGETVCVVGESGCGKSVTALSIMGLIA
ESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSLNPVFTVGEQIVETLRE
HELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQRIMIAVALSCNPKLLIAD
EPTTALDVTIQAQILDLLRQIKEELKTSILLITHDLGVVAEMADYVVVMYGGKVIEEAPV
LEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVGLDEFCYFSGRCEHCMEICK
EEAPNLNVHDENHKVACWLYEERAEQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcggtagtagagctgaaagatttgcaaacacattttcagacagaagaagga
acagtaaaggctgttaatcatgttagctttgcagttcgagaaggtgaaacagtttgtgtt
gtaggtgaatcgggttgcggaaagagtgtaacggcgctatcgattatgggacttattgct
gaatcaggaagtgtagtaggtggagacattttatatgaaggaaaaagtcttttaggtatg
aaagagaaagagcttcgtagtttacgaggaaatgatattgcgatgatattccaagagccg
atgacatcgctgaatcccgtcttcactgtaggagaacaaattgtagaaacgttaagagag
catgaattacttagtaaaaatgaggcgtataaaaaggcaatcgaattaattcgtaaagtt
ggtatagctcgtgcggatgaaattgtccattcgtatccacatgaactaagtggaggcatg
ttacaacgcattatgattgctgttgcgcttagttgtaatcctaagttattaattgctgat
gagccgacaacagctcttgatgttacgattcaagcccaaatattagacttattaaggcaa
ataaaagaggaacttaaaacatccattttattaattacacatgatttaggcgttgtagca
gaaatggctgattacgttgtcgttatgtatggcgggaaagttattgaagaagcaccggta
ctagagatattccaaaatccgaaacacccatatacgaaagggttgttgaaatcaaaacca
gtgatgggaaaacgaatagataaactatattctattccagggcaagttcctaatttagtt
ggtttggatgagttttgctattttagtggtcgttgtgagcattgtatggaaatatgtaaa
gaagaggcaccaaatttgaatgtgcacgatgagaaccataaagtagcttgctggttatat
gaggagcgtgcggaacaatga

DBGET integrated database retrieval system