KEGG   Bacillus toyonensis: Btoyo_2931Help
Entry
Btoyo_2931        CDS       T02901                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bty  Bacillus toyonensis
Pathway
bty00473  D-Alanine metabolism
bty00550  Peptidoglycan biosynthesis
bty01100  Metabolic pathways
bty01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Btoyo_2931
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Btoyo_2931
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Btoyo_2931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bty01011]
    Btoyo_2931
Enzymes [BR:bty01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Btoyo_2931
Peptidoglycan biosynthesis and degradation proteins [BR:bty01011]
 Precursor biosynthesis
  Amino acid ligase
   Btoyo_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHA08874
LinkDB All DBs
Position
2845503..2846588
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEALKMSGAENSISPLSLSTEIIPSATSEEDAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKNREEAYDKVEEKLGYPC
FVKPANLGSSVGINKCKNREELESAFEEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIVAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAIERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ttacagacggctcttgctgctattaaagcgttaaatcaagataaattcgagattcatccg
atttatattacagagcaaggtcaatgggtacgcggtgagcgtattgaaggtgaagtaacg
gatgttgaagctttaaaaatgagcggtgcagaaaattcgatttctccgttatcattaagc
acggaaattattccatctgcaacttctgaggaagatgctatcgacgttatttttccatta
ctacatggaccaaatggtgaagatggaacggttcaagggttattagaattaatgaacatt
ccttatgtaggaaatggtgttctagcatcgtctgccggtatggataaagttgttatgaaa
aatatctttgcagaagctggtttgaaacaagcgaaatatgcatctttcattcgtagtgca
tgggaaaaaaatcgcgaagaagcttatgacaaagtagaagagaagttagggtatccttgc
ttcgtaaaaccagcaaaccttggttcaagtgttggtattaataaatgtaaaaatcgtgaa
gaacttgagagtgcatttgaagaggcattccaattcgaccgcaaaattattgtagaagaa
aatatcgtaggtcgtgaagtagaagttggtgtactaggtaacgacgaaccgaaatgttca
gttgtaggtgaaatcgtaccgaaaaaggacttttatgattataagtcgaagtacatcgat
ggtgatacagcgttaattattccagctgaaatgacagaagaagagtctaatgtaattaag
cgagatgcaattgttgcattccaatctttagatggtgcaggcttaacacgagctgatttc
ttcttaacgaaagacggagaagtatatattaacgaagtaaacacaatgccaggatttacg
ccgtttagtatgttccctctattatggcaacatactggattaccatatccagaattaatt
gaagagctaattcgtttggcgattgaacgtcacgaagaaaaacaaaaaattaaatataca
atataa

DBGET integrated database retrieval system