KEGG   Bacillus toyonensis: Btoyo_3033Help
Entry
Btoyo_3033        CDS       T02901                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A-Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bty  Bacillus toyonensis
Pathway
bty00970  Aminoacyl-tRNA biosynthesis
bty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bty00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Btoyo_3033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bty03029]
    Btoyo_3033
Enzymes [BR:bty01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Btoyo_3033
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Btoyo_3033
Mitochondrial biogenesis [BR:bty03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Btoyo_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHA08947
LinkDB All DBs
Position
2950117..2951574
Genome map
AA seq 485 aa AA seqDB search
MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLTLDEENARAKAKELDA
KIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKMLANFDPIYDATVVQKLKAADTVTIGK
LNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAAGEVLFSLGSDTGGSIRQ
PAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAYLLQAISGIDRMDATSA
NVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLAALKVLEGMGATWEEVSLPH
SKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLLDLYKNTRSEGFGDEVKRRIML
GTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVIIGPTTPTPAFKVGEKVDDPMTM
YANDILTIPVNLAGVPAISVPCGFGANSMPLGLQIIGKHFDEATIYRVAHAFEQATDYHT
KKASL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcattctgtatcagagttacataagaagttaaacaacaaagaaatt
tccgttacggatttagtagaagaatcttacaaacgtattgcggatgttgaagataacgta
aaagcttttcttacattagatgaagaaaatgcacgcgcgaaagcgaaagaattagatgct
aagatcggcgctgaagataatggtttattattcggtatgccaatcggtgtaaaagataac
attgtaactaacggtcttcgtactacttgtgcgagcaaaatgttagcaaactttgatcca
atttacgatgcgacagttgtgcaaaagttaaaagctgctgacacagttacaatcggtaaa
ttaaatatggacgagttcgcaatgggttcttcaaatgaaaactcaggtttctacgctaca
aaaaatccatggaacttagattacgttccaggcggatctagtggtggttctgcagcagct
gtagcagcaggagaagtattattctctctaggttctgatacgggtggttctattcgtcag
ccagctgcatattgcggtgttgtaggtttaaaaccaacttacggacgcgtatctcgttac
ggattagtagcattcgcatcttcacttgaccaaatcggaccgattacacgtacagtagaa
gacaatgcatacttattacaagctatttcaggtattgaccgcatggatgcaacttctgca
aatgttgaagttggaaactacttagctggtttaacaggcgatgttaaaggtttacgcatt
gctgtaccgaaagaatacttaggcgaaggtgttggcgaagaagctcgtgagtcagtacta
gctgctttaaaagtattagaaggtatgggcgcaacttgggaggaagtatctcttccacac
tctaaatacgctctagcaacgtattacttattatcttcttctgaagcatctgctaacctt
tcacgctttgatggcgtacgttacggtgttcgttctgataatgtaaataacttattagat
ctttacaaaaacacacgtagcgaaggtttcggtgacgaagtaaaacgccgtattatgctt
ggtacatttgcacttagctctggttactatgatgcatattacaaaaaagcacaacaagta
cgtacattaattaaaaacgactttgaaaatgtatttgctaactacgatgttattattgga
ccaacaacgccaactccagcatttaaagtgggcgaaaaagtggatgatccaatgacaatg
tatgcaaacgacattttaacaatcccagtaaacttagcaggtgttccagcgatttctgtt
ccatgtggattcggtgctaatagtatgccacttggattacaaatcattggtaaacacttc
gatgaagcgacaatttaccgcgttgcacatgcgtttgagcaagcaacagactatcataca
aaaaaagcaagtctgtaa

DBGET integrated database retrieval system