KEGG   Bacillus toyonensis: Btoyo_3058Help
Entry
Btoyo_3058        CDS       T02901                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bty  Bacillus toyonensis
Brite
KEGG Orthology (KO) [BR:bty00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Btoyo_3058
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Btoyo_3058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_binding_3 FAD_oxidored Thi4 DAO AlaDh_PNT_C Glutaredoxin K_oxygenase NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AHA08972
LinkDB All DBs
Position
complement(2980010..2981536)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSSGDDNVSKDMLSLVDELATMSSKITVEKVELER
TPSFSVNRPDEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVFLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFIGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERARGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcagttaatggagaac
gatattttacttaaagttagctcaggagacgataatgtatctaaagatatgttatctcta
gtagatgaattagctactatgtcatcaaagattacagtagaaaaagttgaactagagaga
acaccaagctttagtgtaaatcgccctgatgaagacactggtgtagtattcgctggtatt
ccattaggacacgaatttacttcattagtgttagctttactacaagttagtggacgtgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttcttaactctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacatcatggcagtaccaacagttttcctaaatggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggcccagctggt
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggtattgagaacttcatcagcgtaaaacgcact
gaaggtcctaagctagtagcaagccttgaagagcacgtaaaagaatacgacatcgatgta
atgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttctacaggtgctcgctggcgtaat
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatactgcccacactgt
gacggtccattattcatcggaaaagatgtagcagttattggcggaggtaactctggtatt
gaagcagctatcgacttagcaggtattgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagagcgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaatcactggtactgacaaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgttcaaatc
ggtcttgtgccaaacacagactggttaggcgaaacagttgaacgcgctcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgctgctttaggc
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system