KEGG   Bacillus toyonensis: Btoyo_4201Help
Entry
Btoyo_4201        CDS       T02901                                 

Definition
(GenBank) DinG family ATP-dependent helicase YpvA
  KO
K03722  ATP-dependent DNA helicase DinG [EC:3.6.4.12]
Organism
bty  Bacillus toyonensis
Brite
KEGG Orthology (KO) [BR:bty00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bty03400]
    Btoyo_4201
Enzymes [BR:bty01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Btoyo_4201
DNA repair and recombination proteins [BR:bty03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    Btoyo_4201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C_2 DEAD DUF327 ResIII LIM DEAD_2 PM0188 Caprin-1_dimer
Motif
Other DBs
NCBI-ProteinID: AHA10072
LinkDB All DBs
Position
4104917..4106854
Genome map
AA seq 645 aa AA seqDB search
MFTEKRLPFEVGKQDNFYDKLNEWIGDVFYDILPEKGFEERDEQIFMAFQLERAFQEKKV
MFAEAGVGTGKTIVYLLYAICYARYTGKPAIIACADETLIEQLVKEEGDIAKLSEALGLS
VDVRLAKSMDNYLCLRKLEDVMSGRAPEVIEDVYYELPQFVFDHGTMQNFTHYGDRKEFP
LLNDEEWSKVNWDYFQDCFTCDSRHRCGQTLSREHYRKAADLIICSQDFYMDHIWTYDAR
KREGQIPLLPESSCVVFDEGHLVEYAAQKALTYRLKQTMMEQLLTRLLQNDIREEFAHLV
EETIWQTERFFDVLQENKKEIEGSDRLEITVTEKVTAEAKRLYAKIGEVGDALVFESEMH
TVNTYDLNIVDEHLDVLEHSLRLFMHEKNVITWGEEGDGAFTLVIMPRAVEEVLQEKVFS
KKIPYIFSSATLSDNDSFAFTANSLGVKDYLSFSVASPFNYEEQMAVNLLSHTKENEWER
KCQYTLENIQKTNGRTLVLFRTTQELAAFKEYVSKEQMSVPFLYEGDQEISQLVSRFQNE
EETVLCAVHLWEGLDIPGSSLSHVIIWSLPFPPNDPVFEAKRKHVNNPFWDVDVPYMILR
LRQGIGRLIRTSDDKGAISIFLSDTEDEKVIEAVKKVLPVEGKEL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtttactgagaagagattaccatttgaagtaggaaaacaagataatttttatgataag
ttgaatgagtggattggagatgtattttacgacatccttccggaaaaaggctttgaagag
cgtgatgaacaaatctttatggcgtttcaattagagcgtgctttccaagagaaaaaagtt
atgttcgcagaagcgggtgtaggaacagggaaaacgattgtataccttttatatgcaatt
tgttatgcgcgttatacaggaaaacctgctattatcgcttgtgcagatgaaacattaatt
gagcagcttgtgaaagaagaaggggacattgctaagttatcagaagcattaggactatct
gttgacgtaagacttgcgaaatcgatggataactatttatgtttacgtaaacttgaagat
gttatgagtggacgagctccagaagtaattgaagacgtatattatgaattaccacagttt
gtatttgatcatggtacgatgcaaaactttactcactatggtgacagaaaagaatttcca
cttttaaatgatgaggaatggtcaaaagtaaactgggattacttccaagattgcttcact
tgtgattcacgtcatcgttgtggacaaactctttctcgtgaacattatcgtaaagcggca
gatttaatcatttgttctcaagatttttatatggatcatatttggacgtacgatgctcgt
aaacgtgaaggacaaattccgttattacctgaaagtagctgcgttgtattcgatgaagga
catcttgtagaatatgcagctcaaaaagctttaacgtaccgtttaaagcaaacgatgatg
gagcagcttttaacgagattgttacagaacgatattcgtgaagagtttgcacatttagta
gaagaaacaatttggcaaacagagcgattctttgatgtgttacaagagaataaaaaggaa
attgaaggttctgatcgtttagaaattactgtgacagaaaaagtaaccgcagaagcgaaa
agactttatgcaaaaatcggtgaagtcggtgatgcactagtatttgagagtgaaatgcat
acagtaaacacatacgatttaaatatcgttgatgaacatttagatgtgttagaacattca
cttcgtcttttcatgcatgagaaaaatgtaattacgtggggtgaagaaggtgatggtgcc
ttcacgttagttattatgccgcgtgcagttgaagaagtgttacaagaaaaagtattctcg
aagaaaattccatacattttctcttctgcgacattatcggacaacgattcgttcgcattt
actgcaaatagcttaggggtaaaagattacttatcattctcagttgcctcaccgtttaat
tatgaagagcaaatggcagtaaacttactatcgcatacgaaagaaaatgaatgggaaaga
aagtgtcaatatacacttgaaaatatacagaaaacgaatggacgtacgcttgtattattc
cgtacaacgcaagaacttgcagcgttcaaagaatatgtaagtaaagagcaaatgtcagtt
ccgttcttatatgaaggggatcaagaaattagtcagctcgtttctcgtttccaaaatgaa
gaagagactgtactttgtgccgttcatttatgggaaggtttagatattccgggttcatca
ttatcacatgtaataatttggtcattaccattccctccaaacgatcctgtgtttgaagcg
aaacgtaagcacgtaaataatccattctgggatgtagatgtgccatatatgattttacgc
cttcgtcaagggattggacgtttaattcgtacgagcgacgataaaggtgctatatcaatc
ttcctatcagatacggaagatgaaaaagtgatagaagcagtgaaaaaagtacttccggta
gaaggtaaagaattataa

DBGET integrated database retrieval system