KEGG   Burkholderia thailandensis H0587: BTL_1648Help
Entry
BTL_1648          CDS       T03113                                 

Definition
(GenBank) transketolase, C-terminal domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00030  Pentose phosphate pathway
btz00710  Carbon fixation in photosynthetic organisms
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
btz01200  Carbon metabolism
btz01230  Biosynthesis of amino acids
Module
btz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
btz_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTL_1648
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTL_1648
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BTL_1648
Enzymes [BR:btz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BTL_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AHI63617
LinkDB All DBs
Position
1:1823076..1823984
Genome map
AA seq 302 aa AA seqDB search
MRPAAHCVQALVERAAHDRRIWVLDGDLADSYGADRFAATHPDRFLMAGIAEQSMVSTAA
GMAACGLRPWVFSFAAFLCYRAYDQIRVGLAQAGMPVTLVGSHSGGCGGPNGKSHLALND
IAVMASLPNVDVWAPASDRDTRFVVDAVMTADRPAYIRYPREPWGELPGEPAECRWIGGR
RRFALVSCGLFSHVANDAAGMLRARGIDAGAVHVARLAPFPADAFAALVDGVDGIWVVDD
HTRFGGLADLLRANGHAVREPAFSWPANWSGDVGPAAELLRRHGLSAADVAGRIAAELAR
GR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccgccgcccattgcgtgcaggcgctcgtcgaacgcgccgcgcatgatcgccgg
atctgggtgctggacggcgatctcgccgattcctacggcgcggaccgtttcgcggcgacc
catccggaccgcttcctgatggcggggatcgccgagcagtcgatggtgtcgacggcggcg
ggaatggccgcgtgcgggctgcggccatgggtgttctcgttcgcggcgttcctgtgctac
cgcgcctacgatcagattcgcgtcggtctcgcgcaggccggcatgcccgtcacgctcgtc
ggctcgcacagcggcggctgcggcggcccgaacggcaagagtcatctggcgctgaacgat
atcgcggtgatggcgtcgctgccgaacgtcgacgtctgggcgcccgcgagcgatcgcgat
acgcgcttcgtcgtcgatgcggtgatgacggcggatcggccggcctacatccgctatccg
cgcgagccttggggcgagctgcccggcgagcccgccgagtgccgatggatcggcgggcgg
cgccggttcgcgctcgtgagctgcgggctgttctcgcacgtcgcaaacgacgcggccggg
atgttgcgcgcacgcggcatcgatgcgggcgcggttcacgtggcgcggctcgcgccgttt
cccgccgacgctttcgccgcgctcgtggacggcgtcgacggaatctgggtcgtcgacgat
cacacgcgcttcggcggcctggccgacctgctgcgcgcgaacggtcacgcggttcgcgaa
cccgcgttcagctggcccgcgaactggagcggcgacgtggggccggcggccgaactgctg
cggcgtcacggcttgtccgccgccgacgtggccgggcggatcgcggccgaactcgcgcgg
gggcgctga

DBGET integrated database retrieval system