KEGG   Burkholderia thailandensis H0587: BTL_1935Help
Entry
BTL_1935          CDS       T03113                                 

Definition
(GenBank) pfkB carbohydrate kinase family protein
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00030  Pentose phosphate pathway
btz01100  Metabolic pathways
btz01120  Microbial metabolism in diverse environments
btz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTL_1935
Enzymes [BR:btz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     BTL_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AHI65846
LinkDB All DBs
Position
1:2141750..2142676
Genome map
AA seq 308 aa AA seqDB search
MPAAFPDVLALGEAMVEFNQARPGEPNYLQGFGGDTSNFCIAAARQGARAGFVSAVGDDH
FGRLLLDLWRGEHVDTSYVRIDDGAPTGVYFVSHGEHGHAFDYLRAGSAASRYAIRDLPL
DALAAARFVHLSGVSLAISTSACDAAFAAIGQARANGARVSFDTNLRLKLWPLPRARAVM
TEALRHTDVCLPSWDDVTALTGLVERDAIVDALLGLGPSVVALKLGREGAYVATPGERRV
VPGFAVDALDATGAGDCFGGAFVARLAAGDDPFSAARYANAAAALSTRGFGAVAPIPSRD
AVERLLNG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccggcggcgtttccggacgtgctcgcgctcggcgaggcgatggtcgaattcaaccag
gcgcggccgggcgaaccgaactatctgcagggcttcggcggcgatacgtcgaacttctgc
atcgccgccgcgcggcagggcgcgcgcgcgggcttcgtgtcggcggtcggcgacgatcac
ttcggccgcctgctgctcgatctgtggcgcggcgagcatgtcgacacgtcgtacgtgcgg
atcgacgacggcgcgccgacgggcgtctacttcgtgtcgcacggcgagcatggccacgcg
ttcgactatctgcgcgcgggctcggccgcgagccgctatgcgatccgcgatctgccgctc
gatgcgctcgcggccgcgcgcttcgtccatctgtcgggcgtgagcctcgcgatcagcacg
agcgcgtgcgatgcggcgttcgccgcgatcgggcaggcgcgtgcgaacggcgcgcgcgtg
agcttcgacacgaacctgcggctcaagctctggccgctgccgcgcgcgcgggcggtgatg
acggaggcgctgcgccataccgacgtctgcctgccgagctgggatgacgtgacggcgctc
accgggctcgtcgagcgcgatgcgatcgtcgatgcgctgctcggcttggggccgagcgtc
gtcgcgctgaagctcggccgcgaaggcgcgtatgtcgcgacgcccggcgagcggcgcgtc
gtgcccggcttcgccgtcgacgcgctcgacgcgacgggcgcgggcgactgcttcggcggc
gcgttcgtcgcgcggcttgccgcgggcgacgatccgttctcggccgcgcgctacgcaaac
gcggcggccgcgctgtcgacgcggggcttcggcgcggtcgcgccgattccgtcgcgcgac
gcggtcgagcggctattgaatgggtga

DBGET integrated database retrieval system