KEGG   Burkholderia thailandensis H0587: BTL_2231Help
Entry
BTL_2231          CDS       T03113                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00310  Lysine degradation
btz00380  Tryptophan metabolism
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
btz01200  Carbon metabolism
Module
btz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTL_2231 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BTL_2231 (sucA)
   00380 Tryptophan metabolism
    BTL_2231 (sucA)
Enzymes [BR:btz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BTL_2231 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AHI63382
LinkDB All DBs
Position
1:complement(2517959..2520823)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSNASD
VAHNPIVESFAQRAKANAFIPRESGANLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKGLRDTYCGTIGAEFMYI
SDPEQKRWWQERLESTRATPNFSADKKKHILNRLTAGEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVISAEDADGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAYASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNVSE
GQAKFNVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFANGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSARIERYLQLCAEHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDGGIDAKKVKRVIACSGRVYY
DLVAHRREAKANDVAIVRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcatatttgttcggcggcaatgcttcg
tatgttgaagaactgtacgaagcctatttggataatccagcgtcggtgccggacaattgg
cgcgaatatttcgacgcgctgcaaaacgtccccgcaaccgacggctcgaatgcgagcgac
gtggctcataacccgatcgtcgagtcgttcgcccagcgcgcgaaagccaacgctttcatc
ccgcgcgaaagcggtgccaatctcgccaccgcccgcaagcaagttcacgttcagtccctc
atcagcgcgtatcgcttcctcggctcgcaatgggccaacctcgatcccctgaagcgccgc
gaacgccccgcgattccggaactggaacccgcgttctacgatttctccgaagccgacctt
gaccagacgttcagcgcgagcaacctgtatttcgggttcgagcaggcgtcgctgcgcgac
attgtcaaggggctgcgcgacacgtactgcggcacgatcggcgccgagttcatgtacatc
agcgatcccgagcagaagcgctggtggcaggagcgtctggagtcgacccgtgcgacgccg
aacttctcggccgacaagaagaagcacatcctgaaccgtctgacggcgggcgaaggcctc
gagcgctatctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggctcgaagggcgtgcaggaa
atcgtcatcggcatggcgcaccgcggccgcctgaacgtgctcgtgaacacgctcggcaag
atgccggcggatctgttcgccgagttcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtccgacatcgcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcc
gcgaaggcgcggatggaccgccgcggcgacgccgacggcctgcaggtgctgcccgtgcag
atccacggcgacgcggcgttcgcgggccagggcgtcgtgatggaaacgctcaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaatcagatcggc
ttcacgacgtcggacccgcgcgacgcgcgctcgacgctgtactgcacggacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagccgtggtcctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctcggccacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgcgcgctgtacgcggagaagctcgtccag
caaggcgtgatcagcgccgaagacgcggacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccaccatacggtcgacccggtgctgtcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggacggacgcggccgacaccgcggtgccgctc
gccgagctcaagcgcctcggcgaacgcatcacgacggtgccggagaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgatcgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgagcacctcgcgtacgcgtcgctcgtcgcgtccggctacgcggtg
cgcctgacgggccaggattcgggccgcggcacgttcacgcaccgccacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacgtctcggaa
ggccaggcgaagttcaacgtgatcgactcggtgctgtccgaagaggcggtgctcggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gatttcgcgaacggcgcgcaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctcacgatgctgttgccgcacggctatgaaggccagggtccg
gagcactcgtcggcgcgcatcgagcgctacctgcagctgtgcgcggagcacaacatgcag
gtcgtccagccgacgacgcccgcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctcatcgtcgcgacgccgaagtcgctgctgcgccacaaggaagcg
gtgtcggatctgtcggagctcgcgaagggttcgttccagccggtgctgggcgaagtcgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgatcgcatgctcgggccgcgtgtattac
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgacgtcgcgatcgtgcggatcgag
cagctctacccgttcgcgcacaagcagttcgaagcggagatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaatcagggtccgtggttctatgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tccgcctcgccggccgtcggctattacgcgaagcactacgagcagcagaaggccctcgtc
gaaggcgcattcggccgcttgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system