KEGG   Burkholderia thailandensis H0587: BTL_2419Help
Entry
BTL_2419          CDS       T03113                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTL_2419 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btz02000]
    BTL_2419 (pstB)
Enzymes [BR:btz01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BTL_2419 (pstB)
Transporters [BR:btz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BTL_2419 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_29 RsgA_GTPase AAA_22 AAA_15 AAA_16 Rad17 AAA_30 PRK AAA_25 AAA_33 ABC_ATPase AAA_5 RNA_helicase AAA_28 TniB AAA_7 G-alpha AAA_14 AAA_24 Pox_ATPase-GT
Motif
Other DBs
NCBI-ProteinID: AHI64794
LinkDB All DBs
Position
1:complement(2744203..2745051)
Genome map
AA seq 282 aa AA seqDB search
MNMAESHLDPSKLATGPAGAGAATVQRPLAPLNAKIEVKNLNFFYNQFHALKNINLSIPE
GKVTAFIGPSGCGKSTLLRTFNKMYALYPEQRAEGEIVMDGENLLQSKLDISLLRARIGM
VFQKPTPFPMSIYDNIAFGVKMFERLTRSEMDDRVEWALTKAALWNEVKDKLSQSGYGLS
GGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELIAELKSDYTVVIVTHNMQQA
ARCSDYTAYMYLGELIEFGETEKIFIKPARKETEDYITGRFG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcagaaagccacctcgatccttcgaaactcgccacggggccggccggcgcc
ggcgcggcgacggtgcagcgtccgctcgcgccgctgaacgcgaagatcgaagtcaagaac
ctgaatttcttctacaaccagtttcacgcgctgaagaacatcaacctgagcattcccgaa
gggaaggtgacggcgttcatcggcccgtcgggctgcggcaagtccacgcttttgcgcacg
ttcaacaagatgtacgcgctctacccggagcagcgcgcggaaggcgagatcgtgatggac
ggcgagaacctgctgcagtcgaagctcgacatctcgctcttgcgcgcgcgcatcggcatg
gtgttccagaagccgacgccgttcccgatgtcgatctacgacaacatcgcgttcggcgtg
aagatgttcgagcggctcacgcgctcggagatggacgaccgcgtcgaatgggcgctcacg
aaggcggcgctctggaacgaagtgaaggacaagctgagccagagcggctatggtctgtcg
ggcgggcagcagcagcgcctttgcatcgcgcgcggcatcgcgatccggcctgaagtgctg
ctcctcgacgagccgtgctcggcgctcgatccgatctcgacgggccgcatcgaagagctg
atcgcggagttgaagagcgactacacggtcgtcatcgtcacgcacaacatgcagcaggcg
gcgcgctgctcggactacaccgcgtacatgtacctcggtgagctgatcgagttcggcgaa
acggagaagatcttcatcaagccggcgcgcaaggaaacggaagactacatcacgggccgc
ttcggctga

DBGET integrated database retrieval system